TkA06G165440 | RubberDandelionOmics

Gene overview

TkA06G165440

Reference: TK1151 Chr: Chr06 Coordinates: 43586193-43587939 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

669 bp · TkA06G165440|TK1151|cDNA

ATGAAGGGACGGAGAATACATGAACAAGAATGGAGGAAGGGGAATTGGACACCCGAAGAAGATAACTTGCTTCTTGAGTATGTTAGAATGCATGGAGAAGGAAGATGGAGTTCTGTAGCCGGTTGTTCAGGTTTGAAAAGGAGTGGCAAGAGTTGCAGGTTAAGATGGGTGAATTACCTAAGGCCCGGTCTAAAAAAATGTCAACTAACACCACAGGAAGAAGGCATCATTATGGAACTTCATGCTTTATGGGGAAACAA...

CDS

Download CDS FASTA

669 bp · TkA06G165440|TK1151|CDS

ATGAAGGGACGGAGAATACATGAACAAGAATGGAGGAAGGGGAATTGGACACCCGAAGAAGATAACTTGCTTCTTGAGTATGTTAGAATGCATGGAGAAGGAAGATGGAGTTCTGTAGCCGGTTGTTCAGGTTTGAAAAGGAGTGGCAAGAGTTGCAGGTTAAGATGGGTGAATTACCTAAGGCCCGGTCTAAAAAAATGTCAACTAACACCACAGGAAGAAGGCATCATTATGGAACTTCATGCTTTATGGGGAAACAA...

Protein

Download Protein FASTA

222 aa · TkA06G165440|TK1151|PROTEIN

MKGRRIHEQEWRKGNWTPEEDNLLLEYVRMHGEGRWSSVAGCSGLKRSGKSCRLRWVNYLRPGLKKCQLTPQEEGIIMELHALWGNKWSTIAKYLPGRTDNEIKNYWRTHFKKKGTPSQNQERQQHKATFSRDQHQQQEHMNDLVLAHVEENKRGMIFESQAKIEETIVSEQHYNQSMMAQDVATWWDTVSENGLWSGFLWNQDNDQYPNEYVIKQSFSSYS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G165440`
TK1151 ID	TkA06G165440
OH-1004 ID	LXL04_033334
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	49.800
Protein coverage (%)	TK1151 84.234 / OH-1004 86.726 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G165440

Location Chr06:43586193-43587939 (-)

Description Similar to MYB305: Myb-related protein 305

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g59780`	Transcription factor.	No verified direct reference in this release
`At1g68320`	Transcription repressor of phosphate (Pi) starvation-induced genes.	Phosphate starvation responses and gibberellic acid biosynthesis are regulated by the MYB62 transcription factor in Arabidopsis.2009 · DOI: 10.1093/mp/ssn081
`At3g46130`	Transcription factor.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033334 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009409 response to cold Biological Process

GO:0009585 red, far-red light phototransduction Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009867 jasmonic acid mediated signaling pathway Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0010597 green leaf volatile biosynthetic process Biological Process

GO:0035865 cellular response to potassium ion Biological Process

KEGG gene cross-reference

ath:AT3G27810

ath:AT5G59780

dosa:Os03g0315400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.955

Rank 1 · TkA06G165440 · TK1151

Cytoplasm0.141

Rank 2 · TkA06G165440 · TK1151

Cell membrane0.018

Rank 3 · TkA06G165440 · TK1151

Mitochondrion0.014

Rank 4 · TkA06G165440 · TK1151

Endoplasmic reticulum0.009

Rank 5 · TkA06G165440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23588HTH_CHD1_Hrp38-40 aa

PF15963Myb_DNA-bind_712-32 aa

PF00249Myb_DNA-binding13-60 aa

PF13921Myb_DNA-bind_616-73 aa

PF00249Myb_DNA-binding70-110 aa

PF13921Myb_DNA-bind_670-113 aa

PF15963Myb_DNA-bind_784-108 aa

PF15786PET117118-172 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G165440	`PF23588`	HTH_CHD1_Hrp3	8	40	0.099	13.4
TkA06G165440	`PF15963`	Myb_DNA-bind_7	12	32	0.0023	18.4
TkA06G165440	`PF00249`	Myb_DNA-binding	13	60	1.6e-36	124.9
TkA06G165440	`PF13921`	Myb_DNA-bind_6	16	73	8.9e-22	77.8
TkA06G165440	`PF00249`	Myb_DNA-binding	70	110	1.6e-36	124.9
TkA06G165440	`PF13921`	Myb_DNA-bind_6	70	113	8.9e-22	77.8
TkA06G165440	`PF15963`	Myb_DNA-bind_7	84	108	0.0023	18.4
TkA06G165440	`PF15786`	PET117	118	172	0.58	11.1
TkA06G165440	`PF15963`	Myb_DNA-bind_7	120	150	0.0023	18.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q4JL84`	Arabidopsis thaliana	sp\|Q4JL84\|MYB59_ARATH Transcription factor MYB59	63.600%	Swiss-Prot	Low
`Q9C9G7`	Arabidopsis thaliana	sp\|Q9C9G7\|MYB62_ARATH Transcription factor MYB62	64.200%	Swiss-Prot	Low
`Q9LX82`	Arabidopsis thaliana	sp\|Q9LX82\|MYB48_ARATH Transcription factor MYB48	66.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card