TkA06G164380 | RubberDandelionOmics

Gene overview

TkA06G164380

Reference: TK1151 Chr: Chr06 Coordinates: 43256952-43260748 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2491 bp · TkA06G164380|TK1151|cDNA

CTCCCGCTGCCTGAATCCCGAAAATGACGACCGACATGGGTCCTCCGCCTCCCCGTAACCCTACCCCCGCCACCACCACCACCTCCGATCAACCTCCATCGAAAGAGAAACCTACCAAAGCAATGGACGGTGCGAAGAAGACATCTATGGGGCCTCCACCTCCAATAAACCCTATTCCCCCAAATAGCGAACCAGAGGAATCCGTACAACCTGAAGAACCACCGCTTCATGTGGACGATGCCGATGCCGCCGCCGCCGCC...

CDS

Download CDS FASTA

2208 bp · TkA06G164380|TK1151|CDS

ATGACGACCGACATGGGTCCTCCGCCTCCCCGTAACCCTACCCCCGCCACCACCACCACCTCCGATCAACCTCCATCGAAAGAGAAACCTACCAAAGCAATGGACGGTGCGAAGAAGACATCTATGGGGCCTCCACCTCCAATAAACCCTATTCCCCCAAATAGCGAACCAGAGGAATCCGTACAACCTGAAGAACCACCGCTTCATGTGGACGATGCCGATGCCGCCGCCGCCGCCGCAGCTGCTGGTTCCGCCACCGT...

Protein

Download Protein FASTA

735 aa · TkA06G164380|TK1151|PROTEIN

MTTDMGPPPPRNPTPATTTTSDQPPSKEKPTKAMDGAKKTSMGPPPPINPIPPNSEPEESVQPEEPPLHVDDADAAAAAAAAGSATVGEDKLPETKKKEQKPSSNVGGGVEVPYTIPPWSEPPCHNYFLEVLKGGSIIDQFDVYEKGAYMFGRVDLCDFVLEHPTISRFHAVLQFNKSGGAFIYDLSSTHGTFINKNQVKKKVYEELHVGDVLRFGHSTRLYIFQGPNDLMPPEKDLKSVKSLKMRQEKRDMEASLQRAK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G164380`
TK1151 ID	TkA06G164380
OH-1004 ID	LXL04_024215
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	89.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G164380`
Location	Chr06:43256952-43260748 (+)
Description	Similar to SLC4A1AP: Kanadaptin
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_024215` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006351 DNA-templated transcription Biological Process GO:0006397 mRNA processing Biological Process GO:0008283 cell population proliferation Biological Process GO:0008380 RNA splicing Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005681 spliceosomal complex Cellular Component GO:0005737 cytoplasm Cellular Component GO:0016607 nuclear speck Cellular Component GO:0003677 DNA binding Molecular Function GO:0003729 mRNA binding Molecular Function GO:0004521 RNA endonuclease activity Molecular Function
KEGG gene cross-reference	ath:AT5G47790 bta:282319 cel:CELE_ZK632.2 hsa:22950 mmu:100336 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.918

Rank 1 · TkA06G164380 · TK1151

Cytoplasm0.172

Rank 2 · TkA06G164380 · TK1151

Mitochondrion0.021

Rank 3 · TkA06G164380 · TK1151

Cell membrane0.020

Rank 4 · TkA06G164380 · TK1151

Endoplasmic reticulum0.012

Rank 5 · TkA06G164380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22360SbsC_spectrin-like74-84 aa

PF16697Yop-YscD_cpl131-217 aa

PF00498FHA149-216 aa

PF19827DUF6308244-270 aa

PF22360SbsC_spectrin-like274-305 aa

PF19827DUF6308289-330 aa

PF04102SlyX339-367 aa

PF19827DUF6308412-496 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G164380	`PF22360`	SbsC_spectrin-like	74	84	0.026	15.9
TkA06G164380	`PF16697`	Yop-YscD_cpl	131	217	7e-09	36.6
TkA06G164380	`PF00498`	FHA	149	216	9.6e-19	68.3
TkA06G164380	`PF19827`	DUF6308	244	270	0.46	11.0
TkA06G164380	`PF22360`	SbsC_spectrin-like	274	305	0.026	15.9
TkA06G164380	`PF19827`	DUF6308	289	330	0.46	11.0
TkA06G164380	`PF04102`	SlyX	339	367	1.8	9.9
TkA06G164380	`PF19827`	DUF6308	412	496	0.46	11.0
TkA06G164380	`PF04102`	SlyX	486	520	1.8	9.9
TkA06G164380	`PF19827`	DUF6308	643	667	0.46	11.0
TkA06G164380	`PF19688`	DUF6189	649	686	0.087	13.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card