LXL04_024215 | RubberDandelionOmics

Gene overview

LXL04_024215

Reference: OH-1004 Chr: Chr05 Coordinates: 84695767-84699489 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2427 bp · LXL04_024215|LXL04_024215|OH1004|cDNA

ATGACGACCGACATGGGTCCTCCGCCTCCCCGTAACCCTACCcccgccaccaccaccacctccgaTCAACCTCCATCGAAAGAGAAACCTACCAAAGCAATGGACGGTGCGAAGAAGACATCTATGGGCCCTCCACCTCCAATAAACCCTATTCCCCCAAACAGCGAACCAGAGGAATCCGTACAACCTGAAGAACTACCGCTTCCTGTGGACGATGCCGATGCCGATGCCGCCGCCGCCGCAGCTGCTGATTCCGCCAC...

CDS

Download CDS FASTA

2427 bp · LXL04_024215|LXL04_024215|OH1004|CDS

ATGACGACCGACATGGGTCCTCCGCCTCCCCGTAACCCTACCCCCGCCACCACCACCACCTCCGATCAACCTCCATCGAAAGAGAAACCTACCAAAGCAATGGACGGTGCGAAGAAGACATCTATGGGCCCTCCACCTCCAATAAACCCTATTCCCCCAAACAGCGAACCAGAGGAATCCGTACAACCTGAAGAACTACCGCTTCCTGTGGACGATGCCGATGCCGATGCCGCCGCCGCCGCAGCTGCTGATTCCGCCAC...

Protein

Download Protein FASTA

808 aa · LXL04_024215|LXL04_024215|OH1004|PROTEIN

MTTDMGPPPPRNPTPATTTTSDQPPSKEKPTKAMDGAKKTSMGPPPPINPIPPNSEPEESVQPEELPLPVDDADADAAAAAAADSATVGEDNLPETKKKEQKPSSNVGAKKTSMGPPPSINPIPPNSEPEESVQPEELPLPVDDADADAAAAAAADSATVGEDNLPETKKKEQKPSSNVGGGVEVPYTIPPWSEPPCHNYFLEVLKGGSIIDQFDVYEKGAYMFGRVDLCDFVLEHPTISRFHAVLQFNKSGGAFIYDLS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024215`
TK1151 ID	TkA06G164380
OH-1004 ID	LXL04_024215
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	89.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024215

Location Chr05:84695767-84699489 (-)

Description Similar to SLC4A1AP: Kanadaptin

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g47790`	Inhibitor of protein-phosphatase 1 (PP1).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024215 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006397 mRNA processing Biological Process

GO:0008283 cell population proliferation Biological Process

GO:0008380 RNA splicing Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005681 spliceosomal complex Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0016607 nuclear speck Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

GO:0004521 RNA endonuclease activity Molecular Function

KEGG gene cross-reference

ath:AT5G47790

bta:282319

cel:CELE_ZK632.2

hsa:22950

mmu:100336

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.856

Rank 1 · LXL04_024215 · OH-1004

Cytoplasm0.210

Rank 2 · LXL04_024215 · OH-1004

Cell membrane0.029

Rank 3 · LXL04_024215 · OH-1004

Mitochondrion0.024

Rank 4 · LXL04_024215 · OH-1004

Endoplasmic reticulum0.020

Rank 5 · LXL04_024215 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16697.11Yop-YscD_cpl204-290 aa

PF00498.32FHA222-289 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024215	`PF16697.11`	Yop-YscD_cpl	204	290	8.3e-09	36.4
LXL04_024215	`PF00498.32`	FHA	222	289	1.1e-18	68.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FIK2`	Arabidopsis thaliana	Protein phosphatase 1 regulatory inhibitor subunit PPP1R8 homolog	42.342%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card