RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA06G157500
Reference: TK1151 Chr: Chr06 Coordinates: 41560142-41568322 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

6244 bp · TkA06G157500|TK1151|cDNA

GGATAAGAAAAACAGAGAAGTGCTGGATTTATCTTATTTTTGCAATCTGATACCCTTTACTTTCCAACAAATTCAGTTCAGCCCGCCAAGACGATACAAACAACCATATCGGCATCTAAGAAACCTTGATCACCGACTAAGCAAAGCTTTAAAAAAATGGCGTTTAATCTGTACATTCAAAGATTCTTTTGTCTCAAGTAATCGCCATGTTTATAACCAACTTTATTAAGCGCAAGTTAGAATCAGTGTTGCAACCATGG...

CDS

Download CDS FASTA

1080 bp · TkA06G157500|TK1151|CDS

ATGTCAGCTGTGATGTTCTCTCAGTGTGGAGATTCTTACATTCGTCGTGTCAGGCATCTGTTACCTGTTTCTCATATTGCAAATGTCACTGTACTTGAAGCCTCTCATAGAGAGGGGACAGAAACTGCTCAAGAAGAAGGAATGTGGGGCATACCAGAAGAGGTTACCGTGGATTTCTCTCAGTTTTATCTTGCCTTAATGGCTACAGATGAATCTGGAAGACTTCAAGAACTTGTGTTTAGTGCAGACATGCATGTGGA...

Protein

Download Protein FASTA

359 aa · TkA06G157500|TK1151|PROTEIN

MSAVMFSQCGDSYIRRVRHLLPVSHIANVTVLEASHREGTETAQEEGMWGIPEEVTVDFSQFYLALMATDESGRLQELVFSADMHVDLKSVNMHKNLSFHLSQFSILSRVLQDSTTHQTTQLQIPLISSSTTTNATTSTSNSSIQLPTEDSQSEYYILKQLSCSITAESPVPRDPPDTPKSTQLWVGSGSISGFEVTISLSQIQMLLSVAELSGASSKETTATVHQSQLRNNNNEEPPRKLEEILQDGSIIALQDVHQHM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA06G157500
TK1151 IDTkA06G157500
OH-1004 IDLXL04_024272
Relationship / confidenceSequence Supported Annotation Or Model Conflict / Review
Protein identity (%)97.500
Protein coverage (%)TK1151 99.721 / OH-1004 12.049
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA06G157500
LocationChr06:41560142-41568322 (-)
DescriptionSimilar to tipC: Putative vacuolar protein sorting-associated protein 13C
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_024272 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000045 autophagosome assembly Biological Process
GO:0006623 protein targeting to vacuole Biological Process
GO:0006869 lipid transport Biological Process
GO:0007005 mitochondrion organization Biological Process
GO:0016236 macroautophagy Biological Process
GO:0045053 protein retention in Golgi apparatus Biological Process
GO:0045324 late endosome to vacuole transport Biological Process
GO:0120009 intermembrane lipid transfer Biological Process
GO:0120010 intermembrane phospholipid transfer Biological Process
GO:0005768 endosome Cellular Component
GO:0005794 Golgi apparatus Cellular Component
GO:0005829 cytosol Cellular Component
KEGG gene cross-reference
cthr:CTHT_0020450
ddi:DDB_G0267422
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.400
Rank 1 · TkA06G157500 · TK1151
Nucleus0.274
Rank 2 · TkA06G157500 · TK1151
Endoplasmic reticulum0.247
Rank 3 · TkA06G157500 · TK1151
Golgi apparatus0.185
Rank 4 · TkA06G157500 · TK1151
Cell membrane0.139
Rank 5 · TkA06G157500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser