TkA06G157450 | RubberDandelionOmics

Gene overview

TkA06G157450

Reference: TK1151 Chr: Chr06 Coordinates: 41538086-41538759 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

399 bp · TkA06G157450|TK1151|cDNA

ATGGGAAAACTAGGAAGAGATCGTCCTCCAAACGTTTCGATCATTAATAAAGATCCCGAGTTCTTCGAAATCTTTCTCCCGAATCGTATATCACACCAACTGCGGATACCACCGGATTTTATCAAGCATTTTGATCAAAAGATACCGGAGACAGTCGTTCTTAAAGATCTTTCCGGTAGAGTCTGGCATGTTGAAGTGAATCGAGAGAAAACTGGAGTCTTTTTGAAGAATGGTTGGAATAGATTTGTGAAAGAAAAGAG...

CDS

Download CDS FASTA

399 bp · TkA06G157450|TK1151|CDS

ATGGGAAAACTAGGAAGAGATCGTCCTCCAAACGTTTCGATCATTAATAAAGATCCCGAGTTCTTCGAAATCTTTCTCCCGAATCGTATATCACACCAACTGCGGATACCACCGGATTTTATCAAGCATTTTGATCAAAAGATACCGGAGACAGTCGTTCTTAAAGATCTTTCCGGTAGAGTCTGGCATGTTGAAGTGAATCGAGAGAAAACTGGAGTCTTTTTGAAGAATGGTTGGAATAGATTTGTGAAAGAAAAGAG...

Protein

Download Protein FASTA

132 aa · TkA06G157450|TK1151|PROTEIN

MGKLGRDRPPNVSIINKDPEFFEIFLPNRISHQLRIPPDFIKHFDQKIPETVVLKDLSGRVWHVEVNREKTGVFLKNGWNRFVKEKSLDLGQFMVFRYNRISSSFTVRTFGKNACMDEDQESGKPLTNGCES

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G157450`
TK1151 ID	TkA06G157450
OH-1004 ID	LXL04_006368
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	33.000
Protein coverage (%)	TK1151 81.061 / OH-1004 42.520 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G157450

Location Chr06:41538086-41538759 (+)

Description Similar to Os03g0212300: B3 domain-containing protein Os03g0212300

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g34400`	B3 domain-containing protein At4g34400.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0197600`	B3 domain-containing protein Os11g0197600.	No verified direct reference in this release
`Os03g0621600`	Putative B3 domain-containing protein Os03g0621600.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006368 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT5G66980

dosa:Os03g0212300

dosa:Os03g0621600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.929

Rank 1 · TkA06G157450 · TK1151

Cytoplasm0.133

Rank 2 · TkA06G157450 · TK1151

Cell membrane0.030

Rank 3 · TkA06G157450 · TK1151

Endoplasmic reticulum0.021

Rank 4 · TkA06G157450 · TK1151

Extracellular0.010

Rank 5 · TkA06G157450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02362B328-112 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G157450	`PF02362`	B3	28	112	2.7e-19	69.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZ05`	Arabidopsis thaliana	sp\|Q9SZ05\|Y3440_ARATH B3 domain-containing protein At4g34400	32.000%	Swiss-Prot	Medium
`Q2R9D2`	Oryza sativa subsp. japonica	sp\|Q2R9D2\|Y1176_ORYSJ B3 domain-containing protein Os11g0197600	33.300%	Swiss-Prot	Medium
`Q851V5`	Oryza sativa subsp. japonica	sp\|Q851V5\|Y3216_ORYSJ Putative B3 domain-containing protein Os03g0621600	32.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card