LXL04_006368 | RubberDandelionOmics

Gene overview

LXL04_006368

Reference: OH-1004 Chr: Chr02 Coordinates: 8978291-8979196 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

765 bp · LXL04_006368|LXL04_006368|OH1004|cDNA

ATGGTGGAACATCAAACGGGAGTTTTAAACTCTGAACAATGGCCTCAATTCTTCAAGCTTTATATGCCTGCGCATTGCTCTACGCAACTGCGAATACCACCTGCGTTTCTCAAGTACTTTGGGGATTCCTTACCCTTCAAGTTTACCCTTCAAACTTCTCCAACAAACTCATGGGAGGTACACATGAACAAAATTGACGACGATGTCTACTTCAAAACCGGATGGGAGAAATTCGCGCAAGATAATCTACTAGAATTCGG...

CDS

Download CDS FASTA

765 bp · LXL04_006368|LXL04_006368|OH1004|CDS

ATGGTGGAACATCAAACGGGAGTTTTAAACTCTGAACAATGGCCTCAATTCTTCAAGCTTTATATGCCTGCGCATTGCTCTACGCAACTGCGAATACCACCTGCGTTTCTCAAGTACTTTGGGGATTCCTTACCCTTCAAGTTTACCCTTCAAACTTCTCCAACAAACTCATGGGAGGTACACATGAACAAAATTGACGACGATGTCTACTTCAAAACCGGATGGGAGAAATTCGCGCAAGATAATCTACTAGAATTCGG...

Protein

Download Protein FASTA

254 aa · LXL04_006368|LXL04_006368|OH1004|PROTEIN

MVEHQTGVLNSEQWPQFFKLYMPAHCSTQLRIPPAFLKYFGDSLPFKFTLQTSPTNSWEVHMNKIDDDVYFKTGWEKFAQDNLLEFGDFLIFYYHGGSNFYVSISGINNCLKDINITNNNIQNQPTVTPLQESETEETSNSHKQATEGIEIEDSNLSFEITVQPSYIKNGFMNMPKRVFYDVVKENRPMRVKLQHLGRTWDVMVSYRCERIKLTSGWKEFARENCLGVGDVCCFKVVDIKPDFYLLDVSFCREM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006368`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006368

Location Chr02:8978291-8979196 (+)

Description Similar to Os03g0212300: B3 domain-containing protein Os03g0212300

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g66980`	Putative B3 domain-containing protein At5g66980.	No verified direct reference in this release
`At3g53310`	B3 domain-containing protein REM20.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0212300`	B3 domain-containing protein Os03g0212300.	No verified direct reference in this release
`Os03g0621600`	Putative B3 domain-containing protein Os03g0621600.	No verified direct reference in this release
`Os03g0621600`	Putative B3 domain-containing protein Os03g0621600.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006368 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT5G66980

dosa:Os03g0212300

dosa:Os03g0621600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.910

Rank 1 · LXL04_006368 · OH-1004

Cytoplasm0.168

Rank 2 · LXL04_006368 · OH-1004

Cell membrane0.032

Rank 3 · LXL04_006368 · OH-1004

Endoplasmic reticulum0.026

Rank 4 · LXL04_006368 · OH-1004

Mitochondrion0.013

Rank 5 · LXL04_006368 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02362.27B317-104 aa

PF02362.27B3159-238 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006368	`PF02362.27`	B3	17	104	8.8e-33	113.0
LXL04_006368	`PF02362.27`	B3	159	238	8.8e-33	113.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FGD2`	Arabidopsis thaliana	Putative B3 domain-containing protein At5g66980	37.168%	Swiss-Prot	weak database homology
`Q8LAV5`	Arabidopsis thaliana	B3 domain-containing protein REM20	36.842%	Swiss-Prot	weak database homology
`Q10Q26`	Oryza sativa subsp. japonica	B3 domain-containing protein Os03g0212300	23.176%	Swiss-Prot	weak database homology
`Q851V5`	Oryza sativa subsp. japonica	Putative B3 domain-containing protein Os03g0621600	24.138%	Swiss-Prot	weak database homology
`Q851V1`	Oryza sativa subsp. japonica	Putative B3 domain-containing protein Os03g0621600	26.715%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card