TkA06G157290 | RubberDandelionOmics

Gene overview

TkA06G157290

Reference: TK1151 Chr: Chr06 Coordinates: 41497798-41500498 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

795 bp · TkA06G157290|TK1151|cDNA

ATGAGATTCAGCCACCACCCGGTACCTTCTCCGTCCACTACCGCAGCTTCATCAGTGAAAATGAATTTCAACAATGGAGATCATAAAGCTTCCTTTTTCAAGATATTACTAAACGACTCAGTAGACTACCTTCCATTGCCGACTACTTTTGCCAAAGAGTTTTTGGAAAAGGGAAACAACAGAAAACAGACACTTGTTCTGAAACCCAAATCGGGTGTCAAATGGAGGGTCAAATACTTAAAGAACGAAGATCGATACTA...

CDS

Download CDS FASTA

795 bp · TkA06G157290|TK1151|CDS

ATGAGATTCAGCCACCACCCGGTACCTTCTCCGTCCACTACCGCAGCTTCATCAGTGAAAATGAATTTCAACAATGGAGATCATAAAGCTTCCTTTTTCAAGATATTACTAAACGACTCAGTAGACTACCTTCCATTGCCGACTACTTTTGCCAAAGAGTTTTTGGAAAAGGGAAACAACAGAAAACAGACACTTGTTCTGAAACCCAAATCGGGTGTCAAATGGAGGGTCAAATACTTAAAGAACGAAGATCGATACTA...

Protein

Download Protein FASTA

264 aa · TkA06G157290|TK1151|PROTEIN

MRFSHHPVPSPSTTAASSVKMNFNNGDHKASFFKILLNDSVDYLPLPTTFAKEFLEKGNNRKQTLVLKPKSGVKWRVKYLKNEDRYYFMDGWLNFIKDNRLQVGDFLVFWLLSASPKSTFQVFCYAPNGCLKHPVGFSAVGKKRCVKDETPDNDDDDNSSQKVHKSITRVLRKSYVHQLPMATGFLKETGLDRYDNVRLRTNEGKIWKVGVSKYGKIRLPNLTRGWNDFWKGNEMNMGNTFQITHVKGNLIHVHVIKSQK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G157290`
TK1151 ID	TkA06G157290
OH-1004 ID	LXL04_024282
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G157290

Location Chr06:41497798-41500498 (+)

Description Similar to Os11g0197600: B3 domain-containing protein Os11g0197600

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0197600`	B3 domain-containing protein Os11g0197600.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024282 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G24690

dosa:Os01g0905400

dosa:Os03g0621600

dosa:Os11g0197600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.967

Rank 1 · TkA06G157290 · TK1151

Cytoplasm0.070

Rank 2 · TkA06G157290 · TK1151

Cell membrane0.022

Rank 3 · TkA06G157290 · TK1151

Endoplasmic reticulum0.017

Rank 4 · TkA06G157290 · TK1151

Mitochondrion0.008

Rank 5 · TkA06G157290 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23935DUF727117-32 aa

PF02362B332-116 aa

PF03754At2g31720-like72-114 aa

PF23935DUF727172-127 aa

PF02362B3182-255 aa

PF03754At2g31720-like203-243 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G157290	`PF23935`	DUF7271	17	32	0.031	15.2
TkA06G157290	`PF02362`	B3	32	116	7.8e-25	87.5
TkA06G157290	`PF03754`	At2g31720-like	72	114	0.0041	17.6
TkA06G157290	`PF23935`	DUF7271	72	127	0.031	15.2
TkA06G157290	`PF02362`	B3	182	255	7.8e-25	87.5
TkA06G157290	`PF03754`	At2g31720-like	203	243	0.0041	17.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q2R9D2`	Oryza sativa subsp. japonica	sp\|Q2R9D2\|Y1176_ORYSJ B3 domain-containing protein Os11g0197600	31.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card