TkA06G141490 | RubberDandelionOmics

Gene overview

TkA06G141490

Reference: TK1151 Chr: Chr06 Coordinates: 37084540-37085296 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

465 bp · TkA06G141490|TK1151|cDNA

ATGTATAGATTTTTAAAAGGCGTTGTCAAATTATTCTGTGATATCTATTTATGGAAACCTTCTGTAAGTGATGTTCAAAAACTTTTCGCTGCACATGAAGAGAGACATGGATTTCTAGACAAAAAAATGGGAGGGCATCATGGAGCACCATCGTTGATATTAGAAGCCGTTGCTTCTCAGGATTTGTGGACTTGGCATGTTTTCTTTGGGGTTGTAGGATCCAACAACGACATCAGTGTTCTCCATCAATCCCCAATATT...

CDS

Download CDS FASTA

465 bp · TkA06G141490|TK1151|CDS

ATGTATAGATTTTTAAAAGGCGTTGTCAAATTATTCTGTGATATCTATTTATGGAAACCTTCTGTAAGTGATGTTCAAAAACTTTTCGCTGCACATGAAGAGAGACATGGATTTCTAGACAAAAAAATGGGAGGGCATCATGGAGCACCATCGTTGATATTAGAAGCCGTTGCTTCTCAGGATTTGTGGACTTGGCATGTTTTCTTTGGGGTTGTAGGATCCAACAACGACATCAGTGTTCTCCATCAATCCCCAATATT...

Protein

Download Protein FASTA

154 aa · TkA06G141490|TK1151|PROTEIN

MYRFLKGVVKLFCDIYLWKPSVSDVQKLFAAHEERHGFLDKKMGGHHGAPSLILEAVASQDLWTWHVFFGVVGSNNDISVLHQSPIFNDMLKGAAPDAHFTVNGREYKFAYYLTDGIYPTYAIIVKTIQLPDGSKDRMFTKKTGINTERCGACF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G141490`
TK1151 ID	TkA06G141490
OH-1004 ID	LXL04_020903
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	62.300
Protein coverage (%)	TK1151 86.364 / OH-1004 15.172 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G141490`
Location	Chr06:37084540-37085296 (-)
Description	Similar to PGL3: Polygalacturonase 1 beta-like protein 3
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_020903` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009827 plant-type cell wall modification Biological Process GO:0009835 fruit ripening Biological Process GO:0042547 cell wall modification involved in multidimensional cell growth Biological Process GO:0071555 cell wall organization Biological Process GO:0005576 extracellular region Cellular Component GO:0009505 plant-type cell wall Cellular Component GO:0048046 apoplast Cellular Component
KEGG gene cross-reference	ath:AT1G23760 ath:AT1G70370 sly:101251775 sly:101252080 sly:543991 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.842

Rank 1 · TkA06G141490 · TK1151

Cytoplasm0.206

Rank 2 · TkA06G141490 · TK1151

Extracellular0.065

Rank 3 · TkA06G141490 · TK1151

Endoplasmic reticulum0.021

Rank 4 · TkA06G141490 · TK1151

Cell membrane0.020

Rank 5 · TkA06G141490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04827Plant_tran45-142 aa

PF13359DDE_Tnp_446-110 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G141490	`PF04827`	Plant_tran	45	142	1.6e-39	136.4
TkA06G141490	`PF13359`	DDE_Tnp_4	46	110	0.086	13.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card