TkA06G131880 | RubberDandelionOmics

Gene overview

TkA06G131880

Reference: TK1151 Chr: Chr06 Coordinates: 34466456-34467545 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

522 bp · TkA06G131880|TK1151|cDNA

TGGACGCTTCTGGTGCTCTCTGTGGTGGTGGGCGAAGCTTCTTCTTGTGTTTGTCTTCCTGGCTGTTTGGGCGTTTGTTTCTTCCTTTGGATTGGACCGTTTCTAATGAATAAGGGATGGTTAGAAAGGTATCCAAAGAAAGCTTCAATCTTGAAACTAGCAGGTGAAGGAAACTGGTTTAATCAATTTAGAGCAGTAGCTTTATTAAGAATCTCCCCATTTCCATACATGGTTTACAACTACTGTGCTGTTGCAACTGA...

CDS

Download CDS FASTA

522 bp · TkA06G131880|TK1151|CDS

ATGTGGGTCGCCGGAATGAGTTTTGGTTACAGTTTTGGCTTCCTTCTAATCATCACCGGAGTTATAATCGGCACTTCACTTCCTTACTTCATCGGCTCCCTTTTCTACCACAAAATTCAAGGATGGTTAGAAAGGTATCCAAAGAAAGCTTCAATCTTGAAACTAGCAGGTGAAGGAAACTGGTTTAATCAATTTAGAGCAGTAGCTTTATTAAGAATCTCCCCATTTCCATACATGGTTTACAACTACTGTGCTGTTGC...

Protein

Download Protein FASTA

173 aa · TkA06G131880|TK1151|PROTEIN

MWVAGMSFGYSFGFLLIITGVIIGTSLPYFIGSLFYHKIQGWLERYPKKASILKLAGEGNWFNQFRAVALLRISPFPYMVYNYCAVATDVKFGPYLFRTLTGMVPEIFVAIYTGIMIRTIADASNDQHSLSASQIICTVGGFLLTIITTVVVTVFAKRRLNELQKDEEQLLLH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G131880`
TK1151 ID	TkA06G131880
OH-1004 ID	LXL04_024550
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 53.395 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G131880`
Location	Chr06:34466456-34467545 (+)
Description	Similar to slr0305: TVP38/TMEM64 family membrane protein slr0305 (Synechocystis sp. (strain PCC 6803 / Kazusa)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_024550` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0043132 NAD transport Biological Process GO:0043462 regulation of ATP-dependent activity Biological Process GO:0044375 regulation of peroxisome size Biological Process GO:0051480 regulation of cytosolic calcium ion concentration Biological Process GO:0055085 transmembrane transport Biological Process GO:0090090 negative regulation of canonical Wnt signaling pathway Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005777 peroxisome Cellular Component GO:0005778 peroxisomal membrane Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005886 plasma membrane Cellular Component
KEGG gene cross-reference	ath:AT2G39970 hsa:169200 mmu:100201 syn:slr0305 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.287

Rank 1 · TkA06G131880 · TK1151

Endoplasmic reticulum0.253

Rank 2 · TkA06G131880 · TK1151

Cell membrane0.214

Rank 3 · TkA06G131880 · TK1151

Cytoplasm0.168

Rank 4 · TkA06G131880 · TK1151

Golgi apparatus0.146

Rank 5 · TkA06G131880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09335VTT_dom3-115 aa

PF31051DUF879013-23 aa

PF12159DUF359369-157 aa

PF06955XET_C78-84 aa

PF31051DUF879096-165 aa

PF09335VTT_dom135-154 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G131880	`PF09335`	VTT_dom	3	115	9.3e-16	59.2
TkA06G131880	`PF31051`	DUF8790	13	23	0.016	15.5
TkA06G131880	`PF12159`	DUF3593	69	157	0.14	12.9
TkA06G131880	`PF06955`	XET_C	78	84	1.1	9.8
TkA06G131880	`PF31051`	DUF8790	96	165	0.016	15.5
TkA06G131880	`PF09335`	VTT_dom	135	154	9.3e-16	59.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card