TkA06G131790 | RubberDandelionOmics

Gene overview

TkA06G131790

Reference: TK1151 Chr: Chr06 Coordinates: 34445618-34447546 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1737 bp · TkA06G131790|TK1151|cDNA

AAACTTGAAACATGGAGGAAGGAAAAGGAAAAGAAGATGAAAAAATTAAAATCAACTCGTATTCATGTGCTTGTGCCATTGTTGCTTCCATGATCTCCATCATCTTTGGTTATGAGACGGGTGTTATGAGTGGAGCGTTGATCTTTATCGAAGAAGACCTTAAAATCAACGACGTACAAGTCCAAGTCCTTGCCGGAATTATCAATTTTTGCGCTCTAGTTGGTGCACTGACCGCCGGCAGAACCTCCGACTACATAGGC...

CDS

Download CDS FASTA

1494 bp · TkA06G131790|TK1151|CDS

ATGGAGGAAGGAAAAGGAAAAGAAGATGAAAAAATTAAAATCAACTCGTATTCATGTGCTTGTGCCATTGTTGCTTCCATGATCTCCATCATCTTTGGTTATGAGACGGGTGTTATGAGTGGAGCGTTGATCTTTATCGAAGAAGACCTTAAAATCAACGACGTACAAGTCCAAGTCCTTGCCGGAATTATCAATTTTTGCGCTCTAGTTGGTGCACTGACCGCCGGCAGAACCTCCGACTACATAGGCCGCCGATACAC...

Protein

Download Protein FASTA

497 aa · TkA06G131790|TK1151|PROTEIN

MEEGKGKEDEKIKINSYSCACAIVASMISIIFGYETGVMSGALIFIEEDLKINDVQVQVLAGIINFCALVGALTAGRTSDYIGRRYTISAASIIFLVGSLLMGFAPTYALLLTGRCVAGIGVGFALVIAPVYSAEISAANSRGILSSLPELGISIGILSGYISNYFLASLPLNIGWRVMFAIAAIPSLGLAIGILGMPESPRWLVMQGRLRDAKQVLSKVSNTKDEAESRLQDIKLAAGIDPNCKDDFVSLKHSTRGQGV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G131790`
TK1151 ID	TkA06G131790
OH-1004 ID	LXL04_024552
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G131790

Location Chr06:34445618-34447546 (-)

Description Similar to PLT6: Probable polyol transporter 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g36670`	Plasma membrane sugar-proton symporter.	No verified direct reference in this release
`At2g18480`	Plasma membrane sugar-proton symporter.	No verified direct reference in this release
`At3g18830`	Plasma membrane broad-spectrum sugar-proton symporter.	Analysis of transport activity of Arabidopsis sugar alcohol permease homolog AtPLT5.2005 · DOI: 10.1074/jbc.m410831200 Arabidopsis POLYOL TRANSPORTER5, a new member of the monosaccharide transporter-like superfamily, mediates H+-Symport of numerous substrates, including myo-inositol, glycerol, and ribose.2005 · DOI: 10.1105/tpc.104.026641
`At2g16120`	Plasma membrane sugar-proton symporter.	No verified direct reference in this release
`At2g16130`	Plasma membrane sugar-proton symporter.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024552 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010311 lateral root formation Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0090406 pollen tube Cellular Component

GO:0005351 carbohydrate:proton symporter activity Molecular Function

GO:0005354 galactose transmembrane transporter activity Molecular Function

GO:0005365 myo-inositol transmembrane transporter activity Molecular Function

GO:0015145 monosaccharide transmembrane transporter activity Molecular Function

GO:0015148 D-xylose transmembrane transporter activity Molecular Function

GO:0015168 glycerol transmembrane transporter activity Molecular Function

GO:0015575 mannitol transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT2G16120

ath:AT2G16130

ath:AT2G18480

ath:AT3G18830

ath:AT4G36670

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.591

Rank 1 · TkA06G131790 · TK1151

Lysosome / Vacuole0.151

Rank 2 · TkA06G131790 · TK1151

Cytoplasm0.112

Rank 3 · TkA06G131790 · TK1151

Endoplasmic reticulum0.089

Rank 4 · TkA06G131790 · TK1151

Mitochondrion0.060

Rank 5 · TkA06G131790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00083Sugar_tr21-480 aa

PF07690MFS_127-421 aa

PF06609TRI1261-208 aa

PF07690MFS_1318-475 aa

PF06609TRI12363-381 aa

PF20258tRNA_Me_trans_C407-456 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G131790	`PF00083`	Sugar_tr	21	480	3.3e-108	363.2
TkA06G131790	`PF07690`	MFS_1	27	421	3.4e-33	115.7
TkA06G131790	`PF06609`	TRI12	61	208	0.00061	19.1
TkA06G131790	`PF07690`	MFS_1	318	475	3.4e-33	115.7
TkA06G131790	`PF06609`	TRI12	363	381	0.00061	19.1
TkA06G131790	`PF20258`	tRNA_Me_trans_C	407	456	0.018	16.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GXR2`	Arabidopsis thaliana	sp\|Q8GXR2\|PLT6_ARATH Probable polyol transporter 6	67.200%	Swiss-Prot	High
`Q9ZNS0`	Arabidopsis thaliana	sp\|Q9ZNS0\|PLT3_ARATH Probable polyol transporter 3	64.100%	Swiss-Prot	High
`Q8VZ80`	Arabidopsis thaliana	sp\|Q8VZ80\|PLT5_ARATH Polyol transporter 5	58.300%	Swiss-Prot	High
`Q9XIH7`	Arabidopsis thaliana	sp\|Q9XIH7\|PLT1_ARATH Putative polyol transporter 1	57.400%	Swiss-Prot	High
`Q9XIH6`	Arabidopsis thaliana	sp\|Q9XIH6\|PLT2_ARATH Putative polyol transporter 2	58.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card