TkA06G130980 | RubberDandelionOmics

Gene overview

TkA06G130980

Reference: TK1151 Chr: Chr06 Coordinates: 34173134-34179266 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1609 bp · TkA06G130980|TK1151|cDNA

GGGAGTGCTTGGGACCCAATTTTCGCTAACGAACGTTTGTTGTACATTATATATTTGTACCGTACAAGTAAGTATTGCGTCCCGCTTTTTACTACTATATCTCACGCTCTACACTATTCCCATTCTCTGGGCGTGGAAAACCTGAACCAAACACTCCATACGTTTCTTACATTTTTTCTGCTCAATTTCTCAGCATATTTTTATTATAAATTCGAAATATATAAAATAAGCAAAACCACTCCATTGCTCCCTCCGCCTCC...

CDS

Download CDS FASTA

867 bp · TkA06G130980|TK1151|CDS

ATGTTGCAAAAATGGCGTGGTCACAAACAGCATGAAAGTAAACCCCTGGATCATGAAAAATTGATCCAAGAACTCAGGACTGCTATCGGACCTCTCTCTGGGCACGCATCAAAATTTTGTACAGATGCATGCCTTAAAAGGTATTTGGAAGCCCGAAGCTGGAATCTTGAAAAAGCCAAAAAAATGTTACAAGACACACTTGAATGGAGGTCAAATTACAAACCTCATGAAATTCGTTGGGAGCAAGTAGCACAAGAAGG...

Protein

Download Protein FASTA

288 aa · TkA06G130980|TK1151|PROTEIN

MLQKWRGHKQHESKPLDHEKLIQELRTAIGPLSGHASKFCTDACLKRYLEARSWNLEKAKKMLQDTLEWRSNYKPHEIRWEQVAQEGETGKVSRGNFVDRFGRPVLIMRPGKQNTKTGEGNVRHLVYLTENAILNLPQGQEQMTWLVDFTGYSLSATNIQPKTSRDIINVLQNHYPERLAIIILYNPPKLFQAFFKVISYFIDPKTYLKIKFVYPNDKDSIEIMNSYFDTDNLPSEFGGKANLNLKYDHEEFSKLMIEDD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G130980`
TK1151 ID	TkA06G130980
OH-1004 ID	LXL04_024567
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G130980

Location Chr06:34173134-34179266 (-)

Description Similar to SPCC23B6.04c: CRAL-TRIO domain-containing protein C23B6.04c (Schizosaccharomyces pombe (strain 972 / ATCC 24843)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g39180`	Required for transport of secretory proteins from the Golgi complex (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024567 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006658 phosphatidylserine metabolic process Biological Process

GO:0008654 phospholipid biosynthetic process Biological Process

GO:0009410 response to xenobiotic stimulus Biological Process

GO:0015914 phospholipid transport Biological Process

GO:0016126 sterol biosynthetic process Biological Process

GO:0043001 Golgi to plasma membrane protein transport Biological Process

GO:0120010 intermembrane phospholipid transfer Biological Process

GO:1901352 negative regulation of phosphatidylglycerol biosynthetic process Biological Process

GO:2001247 positive regulation of phosphatidylcholine biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005768 endosome Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

KEGG gene cross-reference

ddi:DDB_G0269182

sce:YNL231C

sce:YNL264C

spo:2539120

spo:2543637

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.335

Rank 1 · TkA06G130980 · TK1151

Endoplasmic reticulum0.232

Rank 2 · TkA06G130980 · TK1151

Mitochondrion0.230

Rank 3 · TkA06G130980 · TK1151

Peroxisome0.137

Rank 4 · TkA06G130980 · TK1151

Cell membrane0.135

Rank 5 · TkA06G130980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03765CRAL_TRIO_N8-65 aa

PF28801DUF846412-23 aa

PF22566UBA_817-27 aa

PF28528UBA_Pinta40-73 aa

PF22566UBA_843-59 aa

PF28801DUF846444-64 aa

PF00650CRAL_TRIO96-239 aa

PF13716CRAL_TRIO_2102-240 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G130980	`PF03765`	CRAL_TRIO_N	8	65	3.4e-09	37.4
TkA06G130980	`PF28801`	DUF8464	12	23	0.018	15.8
TkA06G130980	`PF22566`	UBA_8	17	27	0.14	12.7
TkA06G130980	`PF28528`	UBA_Pinta	40	73	0.0086	17.0
TkA06G130980	`PF22566`	UBA_8	43	59	0.14	12.7
TkA06G130980	`PF28801`	DUF8464	44	64	0.018	15.8
TkA06G130980	`PF00650`	CRAL_TRIO	96	239	4.4e-36	124.7
TkA06G130980	`PF13716`	CRAL_TRIO_2	102	240	9e-09	36.5
TkA06G130980	`PF28801`	DUF8464	189	228	0.018	15.8
TkA06G130980	`PF03765`	CRAL_TRIO_N	250	272	3.4e-09	37.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JVA9`	Arabidopsis thaliana	sp\|F4JVA9\|SFH2_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH2	28.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card