Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1178 bp · TkA06G123740|TK1151|cDNA
ACCCAAATTGCCATCCAAAGTCCAAACTGCAAAGTACCAAACTGCTTTGTTCTTTTCTTAGTCCCGGGATCACAAGTGAAGGAACCATCATCGGAAAAGCTAAAGATGGCCGCCTCCCAGGCGGTCCACTGGCAATGGGAGAACGCCGCTGCCGGATCCGCAGCTGGTTTTGCTACCGTCACTTTTTCGCATCCCCTCGACGTCGTTCGTACCAGATTCCAAGTTAATGACGGCCAAAACCCTCATCTCCCGAGTTACAA...
684 bp · TkA06G123740|TK1151|CDS
ACCCAAATTGCCATCCAAAGTCCAAACTGCAAAGTACCAAACTGCTTTGTTCTTTTCTTAGTCCCGGGATCACAAGTGAAGGAACCATCATCGGAAAAGCTAAAGATGGCCGCCTCCCAGGCGGTCCACTGGCAATGGGAGAACGCCGCTGCCGGATCCGCAGCTGGTTTTGCTACCGTCACTTTTTCGCATCCCCTCGACGTCGTTCGTACCAGATTCCAAGTTAATGACGGCCAAAACCCTCATCTCCCGAGTTACAA...
Protein
Download Protein FASTA227 aa · TkA06G123740|TK1151|PROTEIN
TQIAIQSPNCKVPNCFVLFLVPGSQVKEPSSEKLKMAASQAVHWQWENAAAGSAAGFATVTFSHPLDVVRTRFQVNDGQNPHLPSYKNTRQALFTIARSEGLRGLYGGFYPAVLGSTISWGLYFYFYSKAKQRYLKNRDELSPGLHLASAAEAGGLVCFLTNPIWLVKTRLQLQTPHHQSRPYSGFHDALKTVVKDEGWKALYKGLAPGLILVRFASESWGYSVYCI
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA06G123740 |
|---|---|
| TK1151 ID | TkA06G123740 |
| OH-1004 ID | LXL04_024622 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 95.500 |
| Protein coverage (%) | TK1151 88.987 / OH-1004 58.721Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA06G123740 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr06:32257293-32266041 (-) | |||||||||
| Description | Similar to FOLT1: Folate transporter 1, chloroplastic | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0046655 folic acid metabolic process Biological Process GO:0055085 transmembrane transport Biological Process GO:1904947 folate import into mitochondrion Biological Process GO:1990548 mitochondrial FAD transmembrane transport Biological Process GO:0005739 mitochondrion Cellular Component GO:0005743 mitochondrial inner membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0009941 chloroplast envelope Cellular Component GO:0031969 chloroplast membrane Cellular Component GO:0008517 folic acid transmembrane transporter activity Molecular Function GO:0015230 FAD transmembrane transporter activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT5G66380 cge:100689360 hsa:81034 mcf:102144981 mmu:69906 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00153Mito_carr46-137 aaPF26768YtrI_N112-141 aaPF00153Mito_carr140-213 aaPF26768YtrI_N194-212 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA06G123740 | PF00153 | Mito_carr | 46 | 137 | 9.9e-40 | 134.9 |
| TkA06G123740 | PF26768 | YtrI_N | 112 | 141 | 0.0066 | 17.0 |
| TkA06G123740 | PF00153 | Mito_carr | 140 | 213 | 9.9e-40 | 134.9 |
| TkA06G123740 | PF26768 | YtrI_N | 194 | 212 | 0.0066 | 17.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.