LXL04_024622 | RubberDandelionOmics

Gene overview

LXL04_024622

Reference: OH-1004 Chr: Chr05 Coordinates: 95345126-95347357 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1042 bp · LXL04_024622|LXL04_024622|OH1004|cDNA

ACCCAAATTGCCATCCAAAGTCCAAACTGCAAAGTACCAAACTGCTTTGTTCTTTTCTTTAGTCCCGGGATCACAAGTGAAGCAACCATCATCGGAAAAGCTAAAGATGGCCGCCTCCCAGGCGGTCCACTGGCAATGGGAGAACGCCGCTGCCGGATCCGCAGCTGGTTTTGCTACCGTCACTTTTTCGCATCCCCTCGACGTCGTTCGTACCAGATTCCAAGTTAATGACGGCCAAAACCCTCATCTCCCGAGTTACA...

CDS

Download CDS FASTA

1035 bp · LXL04_024622|LXL04_024622|OH1004|CDS

TTGCCATCCAAAGTCCAAACTGCAAAGTACCAAACTGCTTTGTTCTTTTCTTTAGTCCCGGGATCACAAGTGAAGCAACCATCATCGGAAAAGCTAAAGATGGCCGCCTCCCAGGCGGTCCACTGGCAATGGGAGAACGCCGCTGCCGGATCCGCAGCTGGTTTTGCTACCGTCACTTTTTCGCATCCCCTCGACGTCGTTCGTACCAGATTCCAAGTTAATGACGGCCAAAACCCTCATCTCCCGAGTTACAAGAACAC...

Protein

Download Protein FASTA

344 aa · LXL04_024622|LXL04_024622|OH1004|PROTEIN

MPSKVQTAKYQTALFFSLVPGSQVKQPSSEKLKMAASQAVHWQWENAAAGSAAGFATVTFSHPLDVVRTRFQVNDGQNPHLPSYKNTRQALFTIARSEGLRGLYGGFYPAVLGSTISWGLYFYFYSKAKQRYLKNRDELSPGLHLASAAEAGGLVCFLTNPIWLVKTRLQLQTPHHQSRPYSGFHDALKTVVKDEGWKALYKGLAPGLILQVSHGAIQFTAYEELRKVLVNFRFEQSVLISSSADLLTTIDYATLGASSK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024622`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024622

Location Chr05:95345126-95347357 (+)

Description Similar to FOLT1: Folate transporter 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g66380`	Mediates folate import into chloroplast.	Folate metabolism in plants: an Arabidopsis homolog of the mammalian mitochondrial folate transporter mediates folate import into chloroplasts.2005 · DOI: 10.1074/jbc.m506045200

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024622 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0046655 folic acid metabolic process Biological Process

GO:0055085 transmembrane transport Biological Process

GO:1904947 folate import into mitochondrion Biological Process

GO:1990548 mitochondrial FAD transmembrane transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0008517 folic acid transmembrane transporter activity Molecular Function

GO:0015230 FAD transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT5G66380

cge:100689360

hsa:81034

mcf:102144981

mmu:69906

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.843

Rank 1 · LXL04_024622 · OH-1004

Cytoplasm0.038

Rank 2 · LXL04_024622 · OH-1004

Plastid0.028

Rank 3 · LXL04_024622 · OH-1004

Peroxisome0.027

Rank 4 · LXL04_024622 · OH-1004

Nucleus0.023

Rank 5 · LXL04_024622 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00153.33Mito_carr44-135 aa

PF00153.33Mito_carr138-231 aa

PF00153.33Mito_carr248-338 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024622	`PF00153.33`	Mito_carr	44	135	1.5e-67	224.1
LXL04_024622	`PF00153.33`	Mito_carr	138	231	1.5e-67	224.1
LXL04_024622	`PF00153.33`	Mito_carr	248	338	1.5e-67	224.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7XA87`	Arabidopsis thaliana	Folate transporter 1, chloroplastic	67.197%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card