TkA06G123190 | RubberDandelionOmics

Gene overview

TkA06G123190

Reference: TK1151 Chr: Chr06 Coordinates: 32077255-32079977 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1117 bp · TkA06G123190|TK1151|cDNA

CATCGATTTTAGGTTATAAAAGGAGTTGAGATTACGAATTACCCAATACCTGTCTTTCTTTTTAATTTTTCATCATCAGTTGGTTGTGGGTTACGTATACAGTTGGTTTAAAAGATCAGTATTGTAGAGGAGATTTAGAGAGAGAAAGTTAGAGAGAGAGATGGGTAGGGGGAAGATAGAGATAAGGAAGATAGAAAATAATACAAACAGACAGGTGACATACTCAAAGAGAAGAAATGGGATATTCAAGAAAGCTCATG...

CDS

Download CDS FASTA

681 bp · TkA06G123190|TK1151|CDS

ATGGGTAGGGGGAAGATAGAGATAAGGAAGATAGAAAATAATACAAACAGACAGGTGACATACTCAAAGAGAAGAAATGGGATATTCAAGAAAGCTCATGAGCTTACTGTTCTCTGTGATGCCAAGGTTTCTCTTATTATGTTCTCCAATACTGGCAAGTTCCATGAGTATATCAGCCCTTCCACCACGACTAAAAAGATGTATGATATGTATCAAACAACTCTAGGTTTTGATCTCTGGAGCTCCCACTATGAGAGGAT...

Protein

Download Protein FASTA

226 aa · TkA06G123190|TK1151|PROTEIN

MGRGKIEIRKIENNTNRQVTYSKRRNGIFKKAHELTVLCDAKVSLIMFSNTGKFHEYISPSTTTKKMYDMYQTTLGFDLWSSHYERMKETMKKLKDTNNKLRREIRQRVLGDNLDGLDMNDLTILEQQMQDSLTVVRERKYHVIKTQTDTCRKRVKNLEQRNGNLRLDYDTIHQLDKKYGMVENEGGYESAVAYSDGVSNLYGFCAHPNNNIADGSGYHPHGHRLT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G123190`
TK1151 ID	TkA06G123190
OH-1004 ID	LXL04_008837
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	54.800
Protein coverage (%)	TK1151 88.053 / OH-1004 86.344 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G123190

Location Chr06:32077255-32079977 (-)

Description Similar to DEFA: Floral homeotic protein DEFICIENS

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g54340`	Probable transcription factor involved in the genetic control of flower development.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008837 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009908 flower development Biological Process

GO:0010093 specification of floral organ identity Biological Process

GO:0030154 cell differentiation Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0048437 floral organ development Biological Process

GO:0005634 nucleus Cellular Component

GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding Molecular Function

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT3G54340

vvi:100233014

vvi:100233029

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.968

Rank 1 · TkA06G123190 · TK1151

Cytoplasm0.089

Rank 2 · TkA06G123190 · TK1151

Cell membrane0.021

Rank 3 · TkA06G123190 · TK1151

Endoplasmic reticulum0.013

Rank 4 · TkA06G123190 · TK1151

Plastid0.009

Rank 5 · TkA06G123190 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00319SRF-TF10-57 aa

PF12998ING26-46 aa

PF12998ING39-60 aa

PF17623B27761-149 aa

PF28231STB2_C80-106 aa

PF01486K-box81-167 aa

PF10046BLOC1_281-103 aa

PF04849HAP1_N82-107 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G123190	`PF00319`	SRF-TF	10	57	2.1e-25	88.6
TkA06G123190	`PF12998`	ING	26	46	6.6	8.1
TkA06G123190	`PF12998`	ING	39	60	6.6	8.1
TkA06G123190	`PF17623`	B277	61	149	0.051	13.4
TkA06G123190	`PF28231`	STB2_C	80	106	2.9	9.1
TkA06G123190	`PF01486`	K-box	81	167	5.3e-20	72.1
TkA06G123190	`PF10046`	BLOC1_2	81	103	0.13	13.4
TkA06G123190	`PF04849`	HAP1_N	82	107	0.012	15.5
TkA06G123190	`PF28121`	VPA1267	82	106	0.51	11.2
TkA06G123190	`PF12998`	ING	82	161	6.6	8.1
TkA06G123190	`PF08656`	DASH_Dad3	83	117	0.32	11.8
TkA06G123190	`PF30907`	IPGA1_CC	84	106	0.055	14.5
TkA06G123190	`PF04977`	DivIC	85	106	0.0044	17.5
TkA06G123190	`PF28297`	CCDC3_C	88	107	3.7	8.6
TkA06G123190	`PF15753`	BLOC1S3	92	152	0.16	12.7
TkA06G123190	`PF28231`	STB2_C	118	178	2.9	9.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P35632`	Arabidopsis thaliana	sp\|P35632\|AP3_ARATH Floral homeotic protein APETALA 3	51.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card