TkA06G117970 | RubberDandelionOmics

Gene overview

TkA06G117970

Reference: TK1151 Chr: Chr06 Coordinates: 30877314-30882040 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3596 bp · TkA06G117970|TK1151|cDNA

GATTTATGTAAGTGGATGACTTCACAAGAAGCGTCTTAAGACTAGTGATCTCGTATGATTAGAAAGATCTTTTTTTATAATATTAAAAATAACATGCCACATACAAAACGCCAACCCAACTATATCATCACATAATGTCACCACTTCAAACTAAACAAAAATGGCATCCGCTCCAAAAACTATTTTCAACAAAATCTCTGCAACCTTAACTTCATCAACAATAAACCACTCACCTGGCAGAAGAAGTCCACGTGGCAACA...

CDS

Download CDS FASTA

3135 bp · TkA06G117970|TK1151|CDS

ATGGCATCCGCTCCAAAAACTATTTTCAACAAAATCTCTGCAACCTTAACTTCATCAACAATAAACCACTCACCTGGCAGAAGAAGTCCACGTGGCAACATCAATCAAGAAGAAATCCGATGCTACAGCGTCTGCGTTGCCCGCCTTGCCATCATGGCTATGCTGGCGATTCTTATTGGTCTATTAACACTTCTCACATGGCATTTCACAAAAGTTTACACAAGAACATCATTAAACGCTTTAGCATACGGCCTTCGATT...

Protein

Download Protein FASTA

1044 aa · TkA06G117970|TK1151|PROTEIN

MASAPKTIFNKISATLTSSTINHSPGRRSPRGNINQEEIRCYSVCVARLAIMAMLAILIGLLTLLTWHFTKVYTRTSLNALAYGLRFELLQRPMLRMWKILNSTVEITTSQVKLSEYVIRKYSKAENQAQQVELYAVMRDLTWALFASHKALDSMSIKYRNGFVQAFHRDLRDKNTYYIYSNLYNYTMAEPLDTNQSLPHQGWNDQTIHGNISAIWYREPLDPDTGIKTGKQMEIPPDELLNIAGISQVPDGAASWHVSV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G117970`
TK1151 ID	TkA06G117970
OH-1004 ID	LXL04_024673
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G117970

Location Chr06:30877314-30882040 (-)

Description Similar to AHK1: Histidine kinase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g17820`	Functions as an osmosensor histidine kinase that detects water stress and transmits the stress signal to a downstream MAPK cascade.	Functional analysis of AHK1/ATHK1 and cytokinin receptor histidine kinases in response to abscisic acid, drought, and salt stress in Arabidopsis.2007 · DOI: 10.1073/pnas.0706547105
`At2g47430`	Essential protein.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2YA15`	Cytokinin receptor related to bacterial two-component regulators.	No verified direct reference in this release
`Os06g0183200`	Cytokinin receptor related to bacterial two-component regulators.	No verified direct reference in this release
`Os02g0738400`	Cytokinin receptor related to bacterial two-component regulators.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024673 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0010375 stomatal complex patterning Biological Process

GO:0010431 seed maturation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0000155 phosphorelay sensor kinase activity Molecular Function

GO:0004673 protein histidine kinase activity Molecular Function

GO:0005034 osmosensor activity Molecular Function

KEGG gene cross-reference

ath:AT2G17820

osa:107275680

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.314

Rank 1 · TkA06G117970 · TK1151

Cell membrane0.256

Rank 2 · TkA06G117970 · TK1151

Golgi apparatus0.189

Rank 3 · TkA06G117970 · TK1151

Cytoplasm0.148

Rank 4 · TkA06G117970 · TK1151

Lysosome / Vacuole0.130

Rank 5 · TkA06G117970 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02743dCache_1252-326 aa

PF02518HATPase_c299-318 aa

PF00512HisKA473-538 aa

PF02518HATPase_c585-734 aa

PF00072Response_reg919-1030 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G117970	`PF02743`	dCache_1	252	326	0.0047	18.0
TkA06G117970	`PF02518`	HATPase_c	299	318	5.1e-20	72.7
TkA06G117970	`PF00512`	HisKA	473	538	1.2e-17	64.4
TkA06G117970	`PF02518`	HATPase_c	585	734	5.1e-20	72.7
TkA06G117970	`PF00072`	Response_reg	919	1030	7.5e-24	84.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SXL4`	Arabidopsis thaliana	sp\|Q9SXL4\|AHK1_ARATH Histidine kinase 1	59.100%	Swiss-Prot	High
`O22267`	Arabidopsis thaliana	sp\|O22267\|CKI1_ARATH Histidine kinase CKI1	35.500%	Swiss-Prot	Low
`A2YA15`	Oryza sativa subsp. indica	sp\|A2YA15\|OHK2_ORYSI Probable histidine kinase 2	27.500%	Swiss-Prot	Low
`Q5SML4`	Oryza sativa subsp. japonica	sp\|Q5SML4\|OHK2_ORYSJ Probable histidine kinase 2	27.500%	Swiss-Prot	Low
`A1A699`	Oryza sativa subsp. japonica	sp\|A1A699\|OHK6_ORYSJ Probable histidine kinase 6	30.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card