Gene Card
Gene overview
cDNA / CDS / Protein Sequences
548 bp · TkA06G117420|TK1151|cDNA
ATATTGTTGCATTAATGGATTCTTATGGAAGAAGTTACGGCGTACAACATCAATCTGGCAACCAACGTCCAAGGTTTAACAACATGCAACCTCACTGGGGTTTCGTTCCACCCTCTCTTCATAGTACTTCAACTCCATTCATGCCTCCACAAATGCATGTGCCCCTTCCCCCTTTTACCAACAGTTTCATGTACCCCGCACGTAAGGTTTCTATCGGTTATGCGGCGCCTGCTATGAATTATTTTCAAGATGCAACTCCA...
546 bp · TkA06G117420|TK1151|CDS
ATTGTTGCATTAATGGATTCTTATGGAAGAAGTTACGGCGTACAACATCAATCTGGCAACCAACGTCCAAGGTTTAACAACATGCAACCTCACTGGGGTTTCGTTCCACCCTCTCTTCATAGTACTTCAACTCCATTCATGCCTCCACAAATGCATGTGCCCCTTCCCCCTTTTACCAACAGTTTCATGTACCCCGCACGTAAGGTTTCTATCGGTTATGCGGCGCCTGCTATGAATTATTTTCAAGATGCAACTCCAAT...
Protein
Download Protein FASTA181 aa · TkA06G117420|TK1151|PROTEIN
IVALMDSYGRSYGVQHQSGNQRPRFNNMQPHWGFVPPSLHSTSTPFMPPQMHVPLPPFTNSFMYPARKVSIGYAAPAMNYFQDATPIPIPDPFRFLPLIPRPDLDEKIITQIDYYFSKENLAKDVHLRQNMDEQGWVSIYLIAGFNRISSLTNNVRLILDVMRASTTVEVKVCSIIFKNLC
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA06G117420 |
|---|---|
| TK1151 ID | TkA06G117420 |
| OH-1004 ID | LXL04_024683 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 91.600 |
| Protein coverage (%) | TK1151 92.265 / OH-1004 75.472Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA06G117420 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr06:30753511-30754420 (+) | |||||||||
| Description | Similar to LARP1B: La-related protein 1B | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006402 mRNA catabolic process Biological Process GO:0009737 response to abscisic acid Biological Process GO:0009738 abscisic acid-activated signaling pathway Biological Process GO:0009749 response to glucose Biological Process GO:0009751 response to salicylic acid Biological Process GO:0009753 response to jasmonic acid Biological Process GO:0010150 leaf senescence Biological Process GO:0010286 heat acclimation Biological Process GO:0042254 ribosome biogenesis Biological Process GO:0045727 positive regulation of translation Biological Process GO:0048255 mRNA stabilization Biological Process GO:0070370 cellular heat acclimation Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT4G35890 ath:AT5G21160 ath:AT5G66100 cng:CNAG_04570 hsa:55132 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF05383La108-163 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA06G117420 | PF05383 | La | 108 | 163 | 3.3e-22 | 78.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.