LXL04_024683 | RubberDandelionOmics

Gene overview

LXL04_024683

Reference: OH-1004 Chr: Chr05 Coordinates: 96653909-96655012 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

639 bp · LXL04_024683|LXL04_024683|OH1004|cDNA

ATGGATTCTTATGGAAGAAGTTACGGCGTACAACATCAATCTGGCAACCAACGTCCAAGGTTTAACAACATGCAACCTCACTGGGGTTTCGTTCCACCCTCTCTTCATACTTCAACTCCATTCATGCCTCCACAAATGCATGTGCCCCTTCCCCCTTTTACCAACAGTTTCATGTACCCCGCACATGCGGCGCCTGCTATGAATTATTTTCAAGATGCAACTCCAATACCGATACCAGACCCTTTCAGGTTTTTGCCGCT...

CDS

Download CDS FASTA

639 bp · LXL04_024683|LXL04_024683|OH1004|CDS

ATGGATTCTTATGGAAGAAGTTACGGCGTACAACATCAATCTGGCAACCAACGTCCAAGGTTTAACAACATGCAACCTCACTGGGGTTTCGTTCCACCCTCTCTTCATACTTCAACTCCATTCATGCCTCCACAAATGCATGTGCCCCTTCCCCCTTTTACCAACAGTTTCATGTACCCCGCACATGCGGCGCCTGCTATGAATTATTTTCAAGATGCAACTCCAATACCGATACCAGACCCTTTCAGGTTTTTGCCGCT...

Protein

Download Protein FASTA

212 aa · LXL04_024683|LXL04_024683|OH1004|PROTEIN

MDSYGRSYGVQHQSGNQRPRFNNMQPHWGFVPPSLHTSTPFMPPQMHVPLPPFTNSFMYPAHAAPAMNYFQDATPIPIPDPFRFLPLIPRPDLDEKIITQIDYYFSKENLAKDVHLRQNMDEQGWVSVYLIAGFNRISSLTNNVRLILDVMRASTTVEVKGEKMRRRDGWMKWPPIPRSLNVESLSSRSECYGGGLEVKGVGMVFIGQPWLK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024683`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024683

Location Chr05:96653909-96655012 (-)

Description Similar to LARP1B: La-related protein 1B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g66100`	Promotes leaf senescence.	No verified direct reference in this release
`At5g21160`	Required for acclimation and survival during thermal stress.	No verified direct reference in this release
`At4g35890`	Promotes leaf senescence mediated by abscisic acid (ABA), salicylic acid (SA) and jasmonic acid (MeJA), probably though the induction of expression of senescence-associated genes (SAGs) and defense-related genes.	Overexpression of a LAM domain containing RNA-binding protein LARP1c induces precocious leaf senescence in Arabidopsis.2012 · DOI: 10.1007/s10059-012-0111-5

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024683 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006402 mRNA catabolic process Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009749 response to glucose Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0010150 leaf senescence Biological Process

GO:0010286 heat acclimation Biological Process

GO:0042254 ribosome biogenesis Biological Process

GO:0045727 positive regulation of translation Biological Process

GO:0048255 mRNA stabilization Biological Process

GO:0070370 cellular heat acclimation Biological Process

KEGG gene cross-reference

ath:AT4G35890

ath:AT5G21160

ath:AT5G66100

cng:CNAG_04570

hsa:55132

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.546

Rank 1 · LXL04_024683 · OH-1004

Nucleus0.534

Rank 2 · LXL04_024683 · OH-1004

Endoplasmic reticulum0.054

Rank 3 · LXL04_024683 · OH-1004

Cell membrane0.042

Rank 4 · LXL04_024683 · OH-1004

Mitochondrion0.036

Rank 5 · LXL04_024683 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05383.24La97-152 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024683	`PF05383.24`	La	97	152	1.1e-21	77.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RWR2`	Arabidopsis thaliana	La-related protein 1B	45.370%	Swiss-Prot	weak database homology
`Q940X9`	Arabidopsis thaliana	La-related protein 1A	41.053%	Swiss-Prot	weak database homology
`Q94K80`	Arabidopsis thaliana	La-related protein 1C	32.275%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card