TkA06G117330 | RubberDandelionOmics

Gene overview

TkA06G117330

Reference: TK1151 Chr: Chr06 Coordinates: 30718420-30719391 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

612 bp · TkA06G117330|TK1151|cDNA

ATGGTGAAGGCTTTAACTTTCGACAAAACTACAGTCAAGAAAGGTGCATGGAGTGAAGAAGAAGACAACAAGTTACGAGCCTATATCCAAAGATACGGCCACTGGAACTGGGGTTTACTTCCAAAGTTTGCTGGTTTGTCTAGAAGCGGGAAGAGTTGCAGGTTGCGATGGATGAATTATCTTCGCCCAGACATCAAACATGGAAACTTCACAAAAGAAGACGATGATATGATTCTCACTTTGCATAAACATCTTGGCAA...

CDS

Download CDS FASTA

612 bp · TkA06G117330|TK1151|CDS

ATGGTGAAGGCTTTAACTTTCGACAAAACTACAGTCAAGAAAGGTGCATGGAGTGAAGAAGAAGACAACAAGTTACGAGCCTATATCCAAAGATACGGCCACTGGAACTGGGGTTTACTTCCAAAGTTTGCTGGTTTGTCTAGAAGCGGGAAGAGTTGCAGGTTGCGATGGATGAATTATCTTCGCCCAGACATCAAACATGGAAACTTCACAAAAGAAGACGATGATATGATTCTCACTTTGCATAAACATCTTGGCAA...

Protein

Download Protein FASTA

203 aa · TkA06G117330|TK1151|PROTEIN

MVKALTFDKTTVKKGAWSEEEDNKLRAYIQRYGHWNWGLLPKFAGLSRSGKSCRLRWMNYLRPDIKHGNFTKEDDDMILTLHKHLGNKWTAIAAKLPGRSDNEIKNRWNSHLKKRVQDDKTESENDHNTESLKPDEVPSCSSFTELPSCNLSDLDYGASSDVTPQTYNCDELSGDFLTEPFLLDITSSIENTTPLSSFDDFFS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G117330`
TK1151 ID	TkA06G117330
OH-1004 ID	LXL04_024690
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	91.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G117330

Location Chr06:30718420-30719391 (-)

Description Similar to MYB4: Transcription factor MYB4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g23250`	Transcription factor involved in cold-regulation of CBF genes and in the development of freezing tolerance.	A R2R3 type MYB transcription factor is involved in the cold regulation of CBF genes and in acquired freezing tolerance.2006 · DOI: 10.1074/jbc.m605895200 Transgenic expression of MYB15 confers enhanced sensitivity to abscisic acid and improved drought tolerance in Arabidopsis thaliana.2009 · DOI: 10.1016/s1673-8527(09)60003-5
`At1g79180`	Transcriptional activator that binds DNA to the AC cis-elements 5'-ACCTACC-3', 5'-ACCAACC-3' and 5'-ACCTAAC-3' of promoters and specifically activates lignin biosynthetic genes during secondary wall formation mediated by SND1.	MYB58 and MYB63 are transcriptional activators of the lignin biosynthetic pathway during secondary cell wall formation in Arabidopsis.2009 · DOI: 10.1105/tpc.108.063321
`At3g12820`	Involved in metal ions homeostasis, including iron ions (Fe) acquisition, via the regulation of NAS4 and NAS2 genes expression.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0517100`	Transcriptional activator involved in cold stress response.	Overexpression of the rice Osmyb4 gene increases chilling and freezing tolerance of Arabidopsis thaliana plants.2004 · DOI: 10.1046/j.1365-313x.2003.01938.x Supra-optimal expression of the cold-regulated OsMyb4 transcription factor in transgenic rice changes the complexity of transcriptional network with major effects on stress tolerance and panicle development.2010 · DOI: 10.1111/j.1365-3040.2010.02221.x The rice Osmyb4 gene enhances tolerance to frost and improves germination under unfavourable conditions in transgenic barley plants.2012 · DOI: 10.1007/s13353-011-0081-x
`Os02g0624300`	Acts as a negative regulator of cold tolerance.	The OsMYB30 Transcription Factor Suppresses Cold Tolerance by Interacting with a JAZ Protein and Suppressing β-Amylase Expression.2017 · DOI: 10.1104/pp.16.01725

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024690 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0050826 response to freezing Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G06180

ath:AT2G31180

ath:AT3G23250

dosa:Os02g0624300

dosa:Os04g0517100

osa:4330027

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.908

Rank 1 · TkA06G117330 · TK1151

Cytoplasm0.206

Rank 2 · TkA06G117330 · TK1151

Mitochondrion0.029

Rank 3 · TkA06G117330 · TK1151

Cell membrane0.019

Rank 4 · TkA06G117330 · TK1151

Endoplasmic reticulum0.009

Rank 5 · TkA06G117330 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09111SLIDE6-36 aa

PF15963Myb_DNA-bind_77-33 aa

PF11626Rap1_C13-27 aa

PF00249Myb_DNA-binding14-61 aa

PF13921Myb_DNA-bind_617-75 aa

PF08914Myb_Rap118-34 aa

PF08914Myb_Rap152-66 aa

PF09111SLIDE63-115 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G117330	`PF09111`	SLIDE	6	36	0.0073	17.0
TkA06G117330	`PF15963`	Myb_DNA-bind_7	7	33	0.025	15.1
TkA06G117330	`PF11626`	Rap1_C	13	27	0.059	14.1
TkA06G117330	`PF00249`	Myb_DNA-binding	14	61	7.1e-33	113.2
TkA06G117330	`PF13921`	Myb_DNA-bind_6	17	75	3.4e-24	85.5
TkA06G117330	`PF08914`	Myb_Rap1	18	34	0.14	13.3
TkA06G117330	`PF08914`	Myb_Rap1	52	66	0.14	13.3
TkA06G117330	`PF09111`	SLIDE	63	115	0.0073	17.0
TkA06G117330	`PF11626`	Rap1_C	63	108	0.059	14.1
TkA06G117330	`PF00249`	Myb_DNA-binding	68	112	7.1e-33	113.2
TkA06G117330	`PF13921`	Myb_DNA-bind_6	70	125	3.4e-24	85.5
TkA06G117330	`PF08914`	Myb_Rap1	70	115	0.14	13.3
TkA06G117330	`PF21227`	Myb_DNA-binding_7	71	109	0.089	13.4
TkA06G117330	`PF15963`	Myb_DNA-bind_7	72	117	0.025	15.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LTC4`	Arabidopsis thaliana	sp\|Q9LTC4\|MYB15_ARATH Transcription factor MYB15	62.700%	Swiss-Prot	Medium
`Q6R0A6`	Arabidopsis thaliana	sp\|Q6R0A6\|MYB63_ARATH Transcription factor MYB63	64.200%	Swiss-Prot	Medium
`Q9LTV4`	Arabidopsis thaliana	sp\|Q9LTV4\|MYB10_ARATH Transcription factor MYB10	63.300%	Swiss-Prot	Medium
`Q7XBH4`	Oryza sativa subsp. japonica	sp\|Q7XBH4\|MYB4_ORYSJ Transcription factor MYB4	64.700%	Swiss-Prot	Medium
`Q6K1S6`	Oryza sativa subsp. japonica	sp\|Q6K1S6\|MYB30_ORYSJ Transcription factor MYB30	61.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card