TkA06G102870 | RubberDandelionOmics

Gene overview

TkA06G102870

Reference: TK1151 Chr: Chr06 Coordinates: 27308783-27313534 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1385 bp · TkA06G102870|TK1151|cDNA

CAGTATCGTACTTGGGATGGCAGTTAGCGACGATGAATCTTTCAATAGAATTTTCAACTTCACATTCTCTCACAATGTCCAACGCTTGACTCTTACTCGCTCGGATGCGGTTACCTGCCCATATTCCTTTTGTGCAACGCCAAGGTGGGACCTCCCATTTTTAACGACGCTGCATCTTCACTGTGTCAAATTTTCTGATGATGATGATGATGATGATGGTCTTTTCTCCAAGTGCACCAATTTGAAGAACCTTTTGTTAA...

CDS

Download CDS FASTA

1053 bp · TkA06G102870|TK1151|CDS

ATGGCAGTTAGCGACGATGAATCTTTCAATAGAATTTTCAACTTCACATTCTCTCACAATGTCCAACGCTTGACTCTTACTCGCTCGGATGCGGTTACCTGCCCATATTCCTTTTGTGCAACGCCAAGGTGGGACCTCCCATTTTTAACGACGCTGCATCTTCACTGTGTCAAATTTTCTGATGATGATGATGATGATGATGGTCTTTTCTCCAAGTGCACCAATTTGAAGAACCTTTTGTTAAGAAGGTGCGGAATGAA...

Protein

Download Protein FASTA

350 aa · TkA06G102870|TK1151|PROTEIN

MAVSDDESFNRIFNFTFSHNVQRLTLTRSDAVTCPYSFCATPRWDLPFLTTLHLHCVKFSDDDDDDDGLFSKCTNLKNLLLRRCGMKGTKVLEICHPRLSNLTLQRTNFDEVVNVVAPQLKNLTIAWCRGKQVVNATGLTSLVLEGFQPWRHSTPTGFHSLDKVDLLMYDPDKADAHELVSLFQHFHSVKLLTLNLEILERLSSSAKQLSHKVFAFTNAKISQFSPKQLLKVYIEVGAQEKVTRPTEITPIAIFPMVSHE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G102870`
TK1151 ID	TkA06G102870
OH-1004 ID	LXL04_028247
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	45.100
Protein coverage (%)	TK1151 98.571 / OH-1004 72.064 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G102870`
Location	Chr06:27308783-27313534 (-)
Description	Similar to At4g13965: Putative F-box/FBD/LRR-repeat protein At4g13965
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_028247` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0005634 nucleus Cellular Component
KEGG gene cross-reference	ath:AT2G04230 ath:AT3G51530 ath:AT5G02930 ath:AT5G56420 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.830

Rank 1 · TkA06G102870 · TK1151

Cytoplasm0.162

Rank 2 · TkA06G102870 · TK1151

Cell membrane0.068

Rank 3 · TkA06G102870 · TK1151

Endoplasmic reticulum0.052

Rank 4 · TkA06G102870 · TK1151

Plastid0.020

Rank 5 · TkA06G102870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07723LRR_24-12 aa

PF24758LRR_At5g5637025-126 aa

PF23622LRR_At1g61320_AtMIF146-126 aa

PF07723LRR_249-63 aa

PF07723LRR_275-93 aa

PF23622LRR_At1g61320_AtMIF1175-201 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G102870	`PF07723`	LRR_2	4	12	0.0046	18.2
TkA06G102870	`PF24758`	LRR_At5g56370	25	126	4e-09	37.2
TkA06G102870	`PF23622`	LRR_At1g61320_AtMIF1	46	126	0.00018	21.7
TkA06G102870	`PF07723`	LRR_2	49	63	0.0046	18.2
TkA06G102870	`PF07723`	LRR_2	75	93	0.0046	18.2
TkA06G102870	`PF23622`	LRR_At1g61320_AtMIF1	175	201	0.00018	21.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card