Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1322 bp · TkA06G094120|TK1151|cDNA
TACCAACAAAATGTAGGGTAAAGGCTAAAGCGAGTATAAAAGTGATCCCTTGGGTTCTAGATGTTCGGCCGACTTGCTTTTCATATGGTAGGGATTAAATCACGTTATATAACCGAATTACAAAGTCAATGTATATAATTAGAAGTGAACACGCCTTGCAGTAATCCCGATATTCAGTCAGATTAACACGCGCAAACTCACGTGTCCAACGGAGGCGCGAAAAGTATAATCACCAAAACCGCCACCACCTTCGTATATCT...
417 bp · TkA06G094120|TK1151|CDS
ATGGCTCTTTTTTCCTACTTCAGCTCCAACAACACGAGCAGGGAATGGAGCAACTCCAAGAGGATGGATTACAGAGGTGACGAATTTGAAAACTCTAGAACAGGCACCGCGCTTTCTTCAATAGCAGATGCATTTGAAGAAATTTCGGATCTCATTATACAAGGAAAAACCACCGATTTCGCTGTTTTGAAATTAAAGCCGTTTTGTGATGCGTGTTCTCTTGTTTCTTGTGCTTCTTTGCTCTTTGGTTGCCTTGGCAT...
Protein
Download Protein FASTA138 aa · TkA06G094120|TK1151|PROTEIN
MALFSYFSSNNTSREWSNSKRMDYRGDEFENSRTGTALSSIADAFEEISDLIIQGKTTDFAVLKLKPFCDACSLVSCASLLFGCLGIAFKFAEMEYTSKVHDLDKSSERYVTLSRIVDYDVNRTQSSHTEAILVIFEE
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA06G094120 |
|---|---|
| TK1151 ID | TkA06G094120 |
| OH-1004 ID | LXL04_021383 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 57.100 |
| Protein coverage (%) | TK1151 95.652 / OH-1004 53.648Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA06G094120 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr06:25000403-25002098 (+) | |||||||||
| Description | Similar to At4g39670: ACD11 homolog protein | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0009751 response to salicylic acid Biological Process GO:0010507 negative regulation of autophagy Biological Process GO:0015031 protein transport Biological Process GO:0032691 negative regulation of interleukin-1 beta production Biological Process GO:0035621 ER to Golgi ceramide transport Biological Process GO:0035627 ceramide transport Biological Process GO:0042742 defense response to bacterium Biological Process GO:0120009 intermembrane lipid transfer Biological Process GO:1902389 ceramide 1-phosphate transport Biological Process GO:0005634 nucleus Cellular Component GO:0005640 nuclear outer membrane Cellular Component GO:0005737 cytoplasm Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT2G34690 ath:AT4G39670 dre:492502 dre:791641 hsa:80772 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF08718GLTP64-133 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA06G094120 | PF08718 | GLTP | 64 | 133 | 5.6e-09 | 37.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.