TkA06G092080 | RubberDandelionOmics

Gene overview

TkA06G092080

Reference: TK1151 Chr: Chr06 Coordinates: 24501592-24505434 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1047 bp · TkA06G092080|TK1151|cDNA

CTCATTTCGAAAATTTCCATGGTTTTCAGGAGCAACCCGCTCGACCTAAACAACTTACCAGAGGATATCGCCAGAGATCATGACAAACAACTCCTTGATGACTCCTCCCCTTCTGCAGGAAGCTACAGAAAAAAGAAAAACGGCGCAAAGGATGAATGTAGGAAGGTCTATGAGTGTAGGTTTTGCTCCCTTAAATTCTGCAAATCTCAAGCCCTTGGGGGACACATGAACCGCCATCGCCAAGAGAGGGAGAATGAGAC...

CDS

Download CDS FASTA

705 bp · TkA06G092080|TK1151|CDS

ATGGTTTTCAGGAGCAACCCGCTCGACCTAAACAACTTACCAGAGGATATCGCCAGAGATCATGACAAACAACTCCTTGATGACTCCTCCCCTTCTGCAGGAAGCTACAGAAAAAAGAAAAACGGCGCAAAGGATGAATGTAGGAAGGTCTATGAGTGTAGGTTTTGCTCCCTTAAATTCTGCAAATCTCAAGCCCTTGGGGGACACATGAACCGCCATCGCCAAGAGAGGGAGAATGAGACGCTATATAGGGCACGTCA...

Protein

Download Protein FASTA

234 aa · TkA06G092080|TK1151|PROTEIN

MVFRSNPLDLNNLPEDIARDHDKQLLDDSSPSAGSYRKKKNGAKDECRKVYECRFCSLKFCKSQALGGHMNRHRQERENETLYRARQLVFGNDNLYQRGSQPTVHGGYHPQPSPAGSNMQGNTLYPTRLFSGASTAVLPPVLPPHQHLYTSPPSRLSNPYSSQHSKSESGKDYFMGHVCSNNSQFIFQNLRPPPDGTNNYTCIGAPVGQTFTVTGGSGGDMSASPINRYHEDGY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G092080`
TK1151 ID	TkA06G092080
OH-1004 ID	LXL04_024975
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 98.291 / OH-1004 91.270 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G092080

Location Chr06:24501592-24505434 (-)

Description Similar to SL1: Zinc finger protein STAMENLESS 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g68480`	Controls the morphogenesis of lateral organs.	No verified direct reference in this release
`At1g13400`	Acts with JAG to promote growth and patterning in stamens and carpels.	No verified direct reference in this release
`At1g67030`	Probable transcription factor required for the initiation of inflorescence trichomes in response to gibberellin and cytokinin.	Zinc Finger Protein 6 (ZFP6) regulates trichome initiation by integrating gibberellin and cytokinin signaling in Arabidopsis thaliana.2013 · DOI: 10.1111/nph.12211 The Arabidopsis ZINC FINGER PROTEIN3 Interferes with Abscisic Acid and Light Signaling in Seed Germination and Plant Development.2014 · DOI: 10.1104/pp.113.234294

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0129200`	Regulates floral organ identity and cell proliferation in the inner floral whorls.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024975 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0009908 flower development Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0009965 leaf morphogenesis Biological Process

GO:0010093 specification of floral organ identity Biological Process

GO:0010094 specification of carpel identity Biological Process

GO:0010097 specification of stamen identity Biological Process

GO:0010158 abaxial cell fate specification Biological Process

GO:0030154 cell differentiation Biological Process

GO:0048437 floral organ development Biological Process

GO:0048440 carpel development Biological Process

GO:0048443 stamen development Biological Process

KEGG gene cross-reference

ath:AT1G13400

ath:AT1G68480

dosa:Os01g0129000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.965

Rank 1 · TkA06G092080 · TK1151

Cytoplasm0.106

Rank 2 · TkA06G092080 · TK1151

Cell membrane0.029

Rank 3 · TkA06G092080 · TK1151

Endoplasmic reticulum0.018

Rank 4 · TkA06G092080 · TK1151

Plastid0.010

Rank 5 · TkA06G092080 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18868zf-C2H2_3rep35-70 aa

PF15319RHINO36-68 aa

PF23224zf-C2H2_2nd_ZNF46249-61 aa

PF13912zf-C2H2_650-76 aa

PF13894zf-C2H2_451-73 aa

PF00096zf-C2H251-73 aa

PF18868zf-C2H2_3rep163-179 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G092080	`PF18868`	zf-C2H2_3rep	35	70	0.023	16.1
TkA06G092080	`PF15319`	RHINO	36	68	0.22	12.3
TkA06G092080	`PF23224`	zf-C2H2_2nd_ZNF462	49	61	1.2	9.5
TkA06G092080	`PF13912`	zf-C2H2_6	50	76	0.0001	22.9
TkA06G092080	`PF13894`	zf-C2H2_4	51	73	0.0066	17.8
TkA06G092080	`PF00096`	zf-C2H2	51	73	0.36	12.1
TkA06G092080	`PF18868`	zf-C2H2_3rep	163	179	0.023	16.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6S591`	Arabidopsis thaliana	sp\|Q6S591\|JAG_ARATH Zinc finger protein JAGGED	38.000%	Swiss-Prot	Medium
`Q6S592`	Arabidopsis thaliana	sp\|Q6S592\|JGL_ARATH Zinc finger protein JAGGED-like	41.900%	Swiss-Prot	Medium
`Q39265`	Arabidopsis thaliana	sp\|Q39265\|ZFP6_ARATH Zinc finger protein 6	33.800%	Swiss-Prot	Medium
`Q9LG97`	Oryza sativa subsp. japonica	sp\|Q9LG97\|SL1_ORYSJ Zinc finger protein STAMENLESS 1	39.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card