LXL04_024975 | RubberDandelionOmics

Gene overview

LXL04_024975

Reference: OH-1004 Chr: Chr05 Coordinates: 103205110-103209316 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

759 bp · LXL04_024975|LXL04_024975|OH1004|cDNA

ATGAAGAGTGAACAAGAGTCCAAAGGCAAGAAGTACGAAACTTGGTTTAAACTCAAGGAATGCATGAGCAACCCGCTCGACCTAAACAACTTACCAGAGGATATCGCCAGAGATCATGACAAACAACTCCTTGATGACTCCTCTCCTTCTGCAGGAAGCTACAGAAAAAAGAAAAACGGCGCAAAGGATGAATGTAGGAAGGTCTATGAGTGTAGGTTTTGCTCCCTTAAATTCTGCAAATCTCAAGCCCTTGGGGGACA...

CDS

Download CDS FASTA

759 bp · LXL04_024975|LXL04_024975|OH1004|CDS

ATGAAGAGTGAACAAGAGTCCAAAGGCAAGAAGTACGAAACTTGGTTTAAACTCAAGGAATGCATGAGCAACCCGCTCGACCTAAACAACTTACCAGAGGATATCGCCAGAGATCATGACAAACAACTCCTTGATGACTCCTCTCCTTCTGCAGGAAGCTACAGAAAAAAGAAAAACGGCGCAAAGGATGAATGTAGGAAGGTCTATGAGTGTAGGTTTTGCTCCCTTAAATTCTGCAAATCTCAAGCCCTTGGGGGACA...

Protein

Download Protein FASTA

252 aa · LXL04_024975|LXL04_024975|OH1004|PROTEIN

MKSEQESKGKKYETWFKLKECMSNPLDLNNLPEDIARDHDKQLLDDSSPSAGSYRKKKNGAKDECRKVYECRFCSLKFCKSQALGGHMNRHRQERENETLYRARQLVFGNDNLYQRGSQPTVHGGYHPQPSPAGSNMQGNTLYPTRLFSGASTAVLPPVLPPHQHLYTSPPSRLSNPYSSQHSKSESGKDYFMGHVCSNNSQFIFQNLRPPPDGTNNYTCIGAPVGQTFTVTGGSGGDMSASPINRYHEDGY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024975`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024975

Location Chr05:103205110-103209316 (+)

Description Similar to SL1: Zinc finger protein STAMENLESS 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g68480`	Controls the morphogenesis of lateral organs.	No verified direct reference in this release
`At1g13400`	Acts with JAG to promote growth and patterning in stamens and carpels.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0129200`	Regulates floral organ identity and cell proliferation in the inner floral whorls.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024975 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0009908 flower development Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0009965 leaf morphogenesis Biological Process

GO:0010093 specification of floral organ identity Biological Process

GO:0010094 specification of carpel identity Biological Process

GO:0010097 specification of stamen identity Biological Process

GO:0010158 abaxial cell fate specification Biological Process

GO:0030154 cell differentiation Biological Process

GO:0048437 floral organ development Biological Process

GO:0048440 carpel development Biological Process

GO:0048443 stamen development Biological Process

KEGG gene cross-reference

ath:AT1G13400

ath:AT1G68480

dosa:Os01g0129000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.968

Rank 1 · LXL04_024975 · OH-1004

Cytoplasm0.097

Rank 2 · LXL04_024975 · OH-1004

Cell membrane0.029

Rank 3 · LXL04_024975 · OH-1004

Endoplasmic reticulum0.017

Rank 4 · LXL04_024975 · OH-1004

Plastid0.010

Rank 5 · LXL04_024975 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6S591`	Arabidopsis thaliana	Zinc finger protein JAGGED	61.538%	Swiss-Prot	weak database homology
`Q6S592`	Arabidopsis thaliana	Zinc finger protein JAGGED-like	39.423%	Swiss-Prot	moderate database homology
`Q9LG97`	Oryza sativa subsp. japonica	Zinc finger protein STAMENLESS 1	40.969%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card