TkA06G088290 | RubberDandelionOmics

Gene overview

TkA06G088290

Reference: TK1151 Chr: Chr06 Coordinates: 23570867-23576537 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2395 bp · TkA06G088290|TK1151|cDNA

AAAAAAGTTTGTTCAAAGGTCTTTATTCTAACATAAACTTACAAAAGTGATGGCATTGCTATCCTTTTGTCATGCACATTGGAGAAACAATCTTAAAACCTTATTAAATTCTCATCCCATAAGACCTACAAAATATATATTTAAAGGAGTCTCAGGAACACAGGTAACATATAGTAAGCATCTAACCTTTTCCTGTTGGGACTTTTTGAAATGATTATCGTCTTCTTTTTGGCCTCTCTTCTTCTCTCTTGTCTACCTTT...

CDS

Download CDS FASTA

1872 bp · TkA06G088290|TK1151|CDS

ATGATTATCGTCTTCTTTTTGGCCTCTCTTCTTCTCTCTTGTCTACCTTTCCTTCATTCTACTACAGACTTCAACACTTCTATGTCTACCTGCCCAAACGGTTTCAGTTGCCCAAAACTTTCCCCTTTTGAGTACCCGTTTTATAATACCACCGACAGCCGGTGTGGTTTGATCAAGGTCAACTGTAGTTCGACTGGTAGCAAAATTAAATTTGGAGAAGAGTCATTTGAGATTGTTTCCAAGTTCGTGCCTGGTCCTTC...

Protein

Download Protein FASTA

623 aa · TkA06G088290|TK1151|PROTEIN

MIIVFFLASLLLSCLPFLHSTTDFNTSMSTCPNGFSCPKLSPFEYPFYNTTDSRCGLIKVNCSSTGSKIKFGEESFEIVSKFVPGPSVVIRNKTFEKLVNETDCDALRDNFTSPSPLLYSIRILPFITLYKCKTNGNDAATMEAYFEQPDYNRYTRCRDHNFYYQYIVSESTIPSDLPSTCEVIRLPVKAQWSNGATQRLNETNIFSLLNSEFSVTFNLSPSCRDCRMREGECHAQDGRFQCLNARKYVAAEKQRFGRTR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G088290`
TK1151 ID	TkA06G088290
OH-1004 ID	LXL04_024998
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	55.200
Protein coverage (%)	TK1151 95.666 / OH-1004 46.677 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G088290

Location Chr06:23570867-23576537 (+)

Description Similar to LRK10L-1.1: LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g38280`	Possesses kinase activity in vitro.	The PR5K receptor protein kinase from Arabidopsis thaliana is structurally related to a family of plant defense proteins.1996 · DOI: 10.1073/pnas.93.6.2598
`At1g66910`	LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 2.5.	No verified direct reference in this release
`At1g67000`	LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 2.8.	No verified direct reference in this release
`At1g66920`	LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 2.4.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024998 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0042631 cellular response to water deprivation Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0048573 photoperiodism, flowering Biological Process

GO:0071215 cellular response to abscisic acid stimulus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0030247 polysaccharide binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G18390

ath:AT1G25390

ath:AT5G38210

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.866

Rank 1 · TkA06G088290 · TK1151

Cytoplasm0.083

Rank 2 · TkA06G088290 · TK1151

Endoplasmic reticulum0.080

Rank 3 · TkA06G088290 · TK1151

Nucleus0.056

Rank 4 · TkA06G088290 · TK1151

Lysosome / Vacuole0.025

Rank 5 · TkA06G088290 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13947GUB_WAK_bind31-67 aa

PF14380WAK_assoc167-244 aa

PF14531Kinase-like288-324 aa

PF03109ABC1319-352 aa

PF00069Pkinase325-593 aa

PF07714PK_Tyr_Ser-Thr325-592 aa

PF03109ABC1435-471 aa

PF10140YukC441-470 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G088290	`PF13947`	GUB_WAK_bind	31	67	0.24	12.5
TkA06G088290	`PF14380`	WAK_assoc	167	244	8.1e-06	27.2
TkA06G088290	`PF14531`	Kinase-like	288	324	0.25	11.3
TkA06G088290	`PF03109`	ABC1	319	352	0.0014	18.6
TkA06G088290	`PF00069`	Pkinase	325	593	9.4e-45	153.8
TkA06G088290	`PF07714`	PK_Tyr_Ser-Thr	325	592	4.1e-42	145.0
TkA06G088290	`PF03109`	ABC1	435	471	0.0014	18.6
TkA06G088290	`PF10140`	YukC	441	470	0.14	11.8
TkA06G088290	`PF14531`	Kinase-like	441	521	0.25	11.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FF29`	Arabidopsis thaliana	sp\|Q9FF29\|PR5K_ARATH PR5-like receptor kinase	56.600%	Swiss-Prot	Medium
`F4HQ20`	Arabidopsis thaliana	sp\|F4HQ20\|LRL25_ARATH LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 2.5	36.300%	Swiss-Prot	Medium
`Q3ECH2`	Arabidopsis thaliana	sp\|Q3ECH2\|LRL28_ARATH LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 2.8	38.100%	Swiss-Prot	Medium
`F4HQ22`	Arabidopsis thaliana	sp\|F4HQ22\|LRL24_ARATH LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 2.4	56.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card