TkA06G088260 | RubberDandelionOmics

Gene overview

TkA06G088260

Reference: TK1151 Chr: Chr06 Coordinates: 23560394-23561461 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1038 bp · TkA06G088260|TK1151|cDNA

GTAGCACTTTGCATAGGATTTGTGATATTCTTGGTTGTGGTGATCTTATGTTTCATAAGGAAACTCAAATGGAGAATAAAGAAAAAGAAGTATCTCAATGTGGAAAGTTTTCTAGAGAATCATGAATTTCTTTCAAAAAGATACTCTTATTTGCACGTAAAGAAGATGACAAACTCATTTGAAGTCAAATTAGGACAAGGTGGCTTTGGTTCCGTGTATAAAGGATCACTAAGTAACGGAAGCCTAGTAGCTGTGAAGAT...

CDS

Download CDS FASTA

1038 bp · TkA06G088260|TK1151|CDS

GTAGCACTTTGCATAGGATTTGTGATATTCTTGGTTGTGGTGATCTTATGTTTCATAAGGAAACTCAAATGGAGAATAAAGAAAAAGAAGTATCTCAATGTGGAAAGTTTTCTAGAGAATCATGAATTTCTTTCAAAAAGATACTCTTATTTGCACGTAAAGAAGATGACAAACTCATTTGAAGTCAAATTAGGACAAGGTGGCTTTGGTTCCGTGTATAAAGGATCACTAAGTAACGGAAGCCTAGTAGCTGTGAAGAT...

Protein

Download Protein FASTA

345 aa · TkA06G088260|TK1151|PROTEIN

VALCIGFVIFLVVVILCFIRKLKWRIKKKKYLNVESFLENHEFLSKRYSYLHVKKMTNSFEVKLGQGGFGSVYKGSLSNGSLVAVKILRDLKGNGEDFINEVASIGRTSHVNIVSLVGFCFEGHQRALIYEFMPNGSLEKFIYGHDFSSNNQLGWEKLHEIAMGIARGLEYLHSGCNTQILHFDIKPHNILLDQNFSPKISDFGLSKLSLKKRSMISMSHMRGTAGYIAPELYSRSFGQVSHKSDVYSYGMMILEMVGGR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G088260`
TK1151 ID	TkA06G088260
OH-1004 ID	LXL04_025001
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	86.200
Protein coverage (%)	TK1151 80.580 / OH-1004 75.260 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G088260

Location Chr06:23560394-23561461 (+)

Description Similar to PR5K: PR5-like receptor kinase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g38280`	Possesses kinase activity in vitro.	The PR5K receptor protein kinase from Arabidopsis thaliana is structurally related to a family of plant defense proteins.1996 · DOI: 10.1073/pnas.93.6.2598
`At1g66920`	LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 2.4.	No verified direct reference in this release
`At1g66980`	Atypical receptor-like kinase involved in disease resistance.	Activation of plant immune responses by a gain-of-function mutation in an atypical receptor-like kinase.2010 · DOI: 10.1104/pp.110.158501
`At1g66910`	LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 2.5.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025001 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009620 response to fungus Biological Process

GO:0010038 response to metal ion Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004675 transmembrane receptor protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0030247 polysaccharide binding Molecular Function

KEGG gene cross-reference

ath:AT1G66910

ath:AT1G66920

ath:AT5G38280

ath:AT5G39020

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.675

Rank 1 · TkA06G088260 · TK1151

Cytoplasm0.165

Rank 2 · TkA06G088260 · TK1151

Endoplasmic reticulum0.112

Rank 3 · TkA06G088260 · TK1151

Nucleus0.108

Rank 4 · TkA06G088260 · TK1151

Golgi apparatus0.048

Rank 5 · TkA06G088260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06734UL9712-38 aa

PF14531Kinase-like24-58 aa

PF03109ABC158-89 aa

PF00069Pkinase61-319 aa

PF07714PK_Tyr_Ser-Thr61-321 aa

PF06734UL97166-196 aa

PF03109ABC1171-207 aa

PF14531Kinase-like177-285 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G088260	`PF06734`	UL97	12	38	0.33	10.8
TkA06G088260	`PF14531`	Kinase-like	24	58	0.0003	20.9
TkA06G088260	`PF03109`	ABC1	58	89	0.00013	21.9
TkA06G088260	`PF00069`	Pkinase	61	319	1.6e-45	156.3
TkA06G088260	`PF07714`	PK_Tyr_Ser-Thr	61	321	2.8e-44	152.1
TkA06G088260	`PF06734`	UL97	166	196	0.33	10.8
TkA06G088260	`PF03109`	ABC1	171	207	0.00013	21.9
TkA06G088260	`PF14531`	Kinase-like	177	285	0.0003	20.9
TkA06G088260	`PF10140`	YukC	177	206	0.079	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FF29`	Arabidopsis thaliana	sp\|Q9FF29\|PR5K_ARATH PR5-like receptor kinase	57.400%	Swiss-Prot	High
`F4HQ22`	Arabidopsis thaliana	sp\|F4HQ22\|LRL24_ARATH LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 2.4	57.400%	Swiss-Prot	High
`D7SFH9`	Arabidopsis thaliana	sp\|D7SFH9\|LRL26_ARATH Protein SUPPRESSOR OF NPR1-1 CONSTITUTIVE 4	52.400%	Swiss-Prot	High
`F4HQ20`	Arabidopsis thaliana	sp\|F4HQ20\|LRL25_ARATH LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 2.5	54.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card