LXL04_025001 | RubberDandelionOmics

Gene overview

LXL04_025001

Reference: OH-1004 Chr: Chr05 Coordinates: 103807178-103810626 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1155 bp · LXL04_025001|LXL04_025001|OH1004|cDNA

atgactcatcagaaccaaacgcgcggccgcgcagaggcagtgcgcgggcgcgcactggTTATTTCCATCGGATCTTTGTCATTGTTGGTCACGATCCTCTGGTTCATAAGGAGACTCAAATGGAGAATAAAGGCAAAGAAGTATCTCAATGTGGAAAAGTTTCTATCAAAGAACGATGTCAATGTGGAAAATTTTCTAAGAAATCATGAATTACTTGCAAAAAGGTACTCTTATTTGCAAGTAAAGAAGATGACAAACTC...

CDS

Download CDS FASTA

1155 bp · LXL04_025001|LXL04_025001|OH1004|CDS

ATGACTCATCAGAACCAAACGCGCGGCCGCGCAGAGGCAGTGCGCGGGCGCGCACTGGTTATTTCCATCGGATCTTTGTCATTGTTGGTCACGATCCTCTGGTTCATAAGGAGACTCAAATGGAGAATAAAGGCAAAGAAGTATCTCAATGTGGAAAAGTTTCTATCAAAGAACGATGTCAATGTGGAAAATTTTCTAAGAAATCATGAATTACTTGCAAAAAGGTACTCTTATTTGCAAGTAAAGAAGATGACAAACTC...

Protein

Download Protein FASTA

384 aa · LXL04_025001|LXL04_025001|OH1004|PROTEIN

MTHQNQTRGRAEAVRGRALVISIGSLSLLVTILWFIRRLKWRIKAKKYLNVEKFLSKNDVNVENFLRNHELLAKRYSYLQVKKMTNSFEVKLGQGGFGSVYKGELSNGSLVAVKILSELKGNGEDFINEVASIGRTSHVNIVSLVGFCFEGHQRALIYEYMPNGSLEKFIYGRSFSSNNHLGWEKLHEISMGIARGLEYLHNGCNTQILHFDIKPHNILLDQNFSPKISDFGLAKLSLETRSMISMSHMRGTPGYIAPEL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025001`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025001

Location Chr05:103807178-103810626 (-)

Description Similar to PR5K: PR5-like receptor kinase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g38280`	Possesses kinase activity in vitro.	The PR5K receptor protein kinase from Arabidopsis thaliana is structurally related to a family of plant defense proteins.1996 · DOI: 10.1073/pnas.93.6.2598
`At5g39020`	Probable receptor-like protein kinase At5g39020.	No verified direct reference in this release
`At1g66910`	LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 2.5.	No verified direct reference in this release
`At1g66920`	LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 2.4.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025001 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009620 response to fungus Biological Process

GO:0010038 response to metal ion Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004675 transmembrane receptor protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0030247 polysaccharide binding Molecular Function

KEGG gene cross-reference

ath:AT1G66910

ath:AT1G66920

ath:AT5G38280

ath:AT5G39020

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.576

Rank 1 · LXL04_025001 · OH-1004

Cytoplasm0.183

Rank 2 · LXL04_025001 · OH-1004

Nucleus0.142

Rank 3 · LXL04_025001 · OH-1004

Endoplasmic reticulum0.128

Rank 4 · LXL04_025001 · OH-1004

Golgi apparatus0.049

Rank 5 · LXL04_025001 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase89-327 aa

PF07714.24PK_Tyr_Ser-Thr89-287 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025001	`PF00069.32`	Pkinase	89	327	2.3e-43	149.2
LXL04_025001	`PF07714.24`	PK_Tyr_Ser-Thr	89	287	6.4e-41	141.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FF29`	Arabidopsis thaliana	PR5-like receptor kinase	54.397%	Swiss-Prot	strong database homology
`Q9FID6`	Arabidopsis thaliana	Probable receptor-like protein kinase At5g39020	47.904%	Swiss-Prot	moderate database homology
`F4HQ20`	Arabidopsis thaliana	LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 2.5	48.936%	Swiss-Prot	moderate database homology
`F4HQ22`	Arabidopsis thaliana	LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 2.4	57.198%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card