TkA06G084940 | RubberDandelionOmics

Gene overview

TkA06G084940

Reference: TK1151 Chr: Chr06 Coordinates: 22679571-22680383 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

591 bp · TkA06G084940|TK1151|cDNA

ATGGCCTGTTCTTCGTCATCGTTTTCTCCTTGCTTATCTCAGCTAACGGCGGCTCTTAAAGCTGTTATAATGTTGCTTCAGTCTGCAGGAGGCTTCGATCACATTAACTCCCCTGAAAGAGGAGCCGTTGAATTCACATCCGAATTCCGAAGTGTTACCTGCAAACTTGAACATGCGTTAGCTAACTTGCCATATGATGATTTTGACATATCGGAGGATACTAAAGAACAAGTTGATTTAGCAAGAAGACAATGTATAAG...

CDS

Download CDS FASTA

591 bp · TkA06G084940|TK1151|CDS

ATGGCCTGTTCTTCGTCATCGTTTTCTCCTTGCTTATCTCAGCTAACGGCGGCTCTTAAAGCTGTTATAATGTTGCTTCAGTCTGCAGGAGGCTTCGATCACATTAACTCCCCTGAAAGAGGAGCCGTTGAATTCACATCCGAATTCCGAAGTGTTACCTGCAAACTTGAACATGCGTTAGCTAACTTGCCATATGATGATTTTGACATATCGGAGGATACTAAAGAACAAGTTGATTTAGCAAGAAGACAATGTATAAG...

Protein

Download Protein FASTA

196 aa · TkA06G084940|TK1151|PROTEIN

MACSSSSFSPCLSQLTAALKAVIMLLQSAGGFDHINSPERGAVEFTSEFRSVTCKLEHALANLPYDDFDISEDTKEQVDLARRQCIRARQRYETTDIHHHEYDHGVESIVRDEKASDQVEILAEFMCPITRDLIRDPVIVSTGQTYERLDIQMWINSGKKTCPKTRLKLRNFTLIPNYALRNLVAEWCKHHNISIH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G084940`
TK1151 ID	TkA06G084940
OH-1004 ID	LXL04_025047
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	47.000
Protein coverage (%)	TK1151 99.490 / OH-1004 37.891 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G084940

Location Chr06:22679571-22680383 (-)

Description Similar to PUB11: U-box domain-containing protein 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g71020`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At1g23030`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At5g42340`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2ZLU6`	Defense related protein that negatively regulates programmed cell death.	No verified direct reference in this release
`Os12g0570000`	E3 ubiquitin-protein ligase that negatively regulates programmed cell death and disease resistance.	Spotted leaf11, a negative regulator of plant cell death and defense, encodes a U-box/armadillo repeat protein endowed with E3 ubiquitin ligase activity.2004 · DOI: 10.1105/tpc.104.025171 SPIN1, a K homology domain protein negatively regulated and ubiquitinated by the E3 ubiquitin ligase SPL11, is involved in flowering time control in rice.2008 · DOI: 10.1105/tpc.108.058610

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025047 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007166 cell surface receptor signaling pathway Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031648 protein destabilization Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0050777 negative regulation of immune response Biological Process

GO:0051865 protein autoubiquitination Biological Process

GO:0090333 regulation of stomatal closure Biological Process

GO:2000022 regulation of jasmonic acid mediated signaling pathway Biological Process

GO:2000028 regulation of photoperiodism, flowering Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT1G23030

ath:AT1G71020

ath:AT3G46510

dosa:Os06g0102700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.516

Rank 1 · TkA06G084940 · TK1151

Nucleus0.496

Rank 2 · TkA06G084940 · TK1151

Cell membrane0.098

Rank 3 · TkA06G084940 · TK1151

Endoplasmic reticulum0.051

Rank 4 · TkA06G084940 · TK1151

Mitochondrion0.045

Rank 5 · TkA06G084940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25368PUB10_N5-88 aa

PF30316TP_077766-94 aa

PF13445zf-RING_UBOX83-90 aa

PF04564U-box124-192 aa

PF11789zf-Nse124-163 aa

PF30316TP_0777126-138 aa

PF13445zf-RING_UBOX127-163 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G084940	`PF25368`	PUB10_N	5	88	1.4e-18	68.5
TkA06G084940	`PF30316`	TP_0777	66	94	0.072	14.1
TkA06G084940	`PF13445`	zf-RING_UBOX	83	90	0.16	12.7
TkA06G084940	`PF04564`	U-box	124	192	4e-19	69.3
TkA06G084940	`PF11789`	zf-Nse	124	163	0.00052	20.5
TkA06G084940	`PF30316`	TP_0777	126	138	0.072	14.1
TkA06G084940	`PF13445`	zf-RING_UBOX	127	163	0.16	12.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C9A6`	Arabidopsis thaliana	sp\|Q9C9A6\|PUB10_ARATH U-box domain-containing protein 10	36.700%	Swiss-Prot	Medium
`Q8GUG9`	Arabidopsis thaliana	sp\|Q8GUG9\|PUB11_ARATH U-box domain-containing protein 11	58.800%	Swiss-Prot	Low
`Q681N2`	Arabidopsis thaliana	sp\|Q681N2\|PUB15_ARATH U-box domain-containing protein 15	54.200%	Swiss-Prot	Low
`A2ZLU6`	Oryza sativa subsp. indica	sp\|A2ZLU6\|SL11_ORYSI Protein spotted leaf 11	29.600%	Swiss-Prot	Low
`Q0IMG9`	Oryza sativa subsp. japonica	sp\|Q0IMG9\|SL11_ORYSJ E3 ubiquitin-protein ligase SPL11	29.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card