TkA06G078500 | RubberDandelionOmics

Gene overview

TkA06G078500

Reference: TK1151 Chr: Chr06 Coordinates: 21064607-21064978 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

372 bp · TkA06G078500|TK1151|cDNA

ATGCACAGGTTGCCCCTCCTAAGCTACGCCCCTGGAGAAGACGACACGATTCTTCGAGCGCATGCTCAATTTGGGGACAAGTGGGCCAAAATAGCCCGATTGTTGTACGATCGGCCGGATTACGCCTTAAGAAATCACTGGAATTCAACGTTGAAGAGAAGGTCTTGGTCTATTCAACAGCCTTCGTCCAAAAGGTCGGCCATTGGTGGTTCGAGTTCGACGGTTCCTGTTCCCGGAAGTTATTTGAATCCCGGATCCGA...

CDS

Download CDS FASTA

372 bp · TkA06G078500|TK1151|CDS

ATGCACAGGTTGCCCCTCCTAAGCTACGCCCCTGGAGAAGACGACACGATTCTTCGAGCGCATGCTCAATTTGGGGACAAGTGGGCCAAAATAGCCCGATTGTTGTACGATCGGCCGGATTACGCCTTAAGAAATCACTGGAATTCAACGTTGAAGAGAAGGTCTTGGTCTATTCAACAGCCTTCGTCCAAAAGGTCGGCCATTGGTGGTTCGAGTTCGACGGTTCCTGTTCCCGGAAGTTATTTGAATCCCGGATCCGA...

Protein

Download Protein FASTA

123 aa · TkA06G078500|TK1151|PROTEIN

MHRLPLLSYAPGEDDTILRAHAQFGDKWAKIARLLYDRPDYALRNHWNSTLKRRSWSIQQPSSKRSAIGGSSSTVPVPGSYLNPGSDTMMPEFLFPQTAGPATADPQIEVSISSTEEGSDVEI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G078500`
TK1151 ID	TkA06G078500
OH-1004 ID	LXL04_013573
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	53.800
Protein coverage (%)	TK1151 65.854 / OH-1004 26.727 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G078500

Location Chr06:21064607-21064978 (-)

Description Similar to MYB44: Transcription factor MYB44

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g67300`	Transcription factor.	Overexpression of AtMYB44 enhances stomatal closure to confer abiotic stress tolerance in transgenic Arabidopsis.2008 · DOI: 10.1104/pp.107.110981 Two novel MYB homologues with changed expression in late embryogenesis-defective Arabidopsis mutants.1998 · DOI: 10.1023/a:1006011002499
`At4g37260`	Transcription factor that functions in salt stress response.	Loss of the R2R3 MYB, AtMyb73, causes hyper-induction of the SOS1 and SOS3 genes in response to high salinity in Arabidopsis.2013 · DOI: 10.1016/j.jplph.2013.05.011
`At3g50060`	Transcription factor involved in auxin response.	The Arabidopsis transcription factor MYB77 modulates auxin signal transduction.2007 · DOI: 10.1105/tpc.107.050963
`At3g09230`	Transcription factor MYB1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013573 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009408 response to heat Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009555 pollen development Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0010929 positive regulation of auxin mediated signaling pathway Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

KEGG gene cross-reference

ath:AT2G39880

ath:AT3G09230

ath:AT3G50060

ath:AT4G37260

ath:AT5G67300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.943

Rank 1 · TkA06G078500 · TK1151

Cytoplasm0.193

Rank 2 · TkA06G078500 · TK1151

Mitochondrion0.018

Rank 3 · TkA06G078500 · TK1151

Cell membrane0.014

Rank 4 · TkA06G078500 · TK1151

Endoplasmic reticulum0.007

Rank 5 · TkA06G078500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249Myb_DNA-binding11-50 aa

PF13921Myb_DNA-bind_611-53 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G078500	`PF00249`	Myb_DNA-binding	11	50	2e-10	41.4
TkA06G078500	`PF13921`	Myb_DNA-bind_6	11	53	1.7e-05	25.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FDW1`	Arabidopsis thaliana	sp\|Q9FDW1\|MYB44_ARATH Transcription factor MYB44	49.400%	Swiss-Prot	Medium
`O23160`	Arabidopsis thaliana	sp\|O23160\|MYB73_ARATH Transcription factor MYB73	41.200%	Swiss-Prot	Medium
`Q9SN12`	Arabidopsis thaliana	sp\|Q9SN12\|MYB77_ARATH Transcription factor MYB77	65.200%	Swiss-Prot	Low
`Q42575`	Arabidopsis thaliana	sp\|Q42575\|MYB1_ARATH Transcription factor MYB1	55.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card