LXL04_013573 | RubberDandelionOmics

Gene overview

LXL04_013573

Reference: OH-1004 Chr: Chr03 Coordinates: 31973425-31974426 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1002 bp · LXL04_013573|LXL04_013573|OH1004|cDNA

ATGGATCGAATCAAAGGCCCATGGAGCCCCGATGAAGACGAGTTGCTGCAGCAGCTTGTCGAGAAGCATGGCCCGAGAAATTGGTCGCTTATCAGCAAATCTATACCTGGTAGATCTGGTAAATCGTGCCGGTTGCGGTGGTGTAACCAGCTGTCGCCGCAGGTGGAACACCGGGCTTTTACGCCGGAAGAGGATGAAACGATCCTACGCGCTCATGCCCGGTTTGGTAACAAATGGGCGACGATTGCCCGGCTTTTATC...

CDS

Download CDS FASTA

1002 bp · LXL04_013573|LXL04_013573|OH1004|CDS

ATGGATCGAATCAAAGGCCCATGGAGCCCCGATGAAGACGAGTTGCTGCAGCAGCTTGTCGAGAAGCATGGCCCGAGAAATTGGTCGCTTATCAGCAAATCTATACCTGGTAGATCTGGTAAATCGTGCCGGTTGCGGTGGTGTAACCAGCTGTCGCCGCAGGTGGAACACCGGGCTTTTACGCCGGAAGAGGATGAAACGATCCTACGCGCTCATGCCCGGTTTGGTAACAAATGGGCGACGATTGCCCGGCTTTTATC...

Protein

Download Protein FASTA

333 aa · LXL04_013573|LXL04_013573|OH1004|PROTEIN

MDRIKGPWSPDEDELLQQLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFTPEEDETILRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSMTNEEFADFAIQQPSLKRSVSAGSAVAGSGLFFNPGSPTGSDISDSSVPPLSSPHVFRPVARPCPIVPPPIEVPKSCPQPPPPPPVNDPPTSLSLSLPGVESQTATPMQLMPPSPTLAAPPPSPVPIPATPLQQVPSNRSLEINLNNEAEFM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013573`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013573

Location Chr03:31973425-31974426 (+)

Description Similar to MYB44: Transcription factor MYB44

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g67300`	Transcription factor.	Overexpression of AtMYB44 enhances stomatal closure to confer abiotic stress tolerance in transgenic Arabidopsis.2008 · DOI: 10.1104/pp.107.110981 Two novel MYB homologues with changed expression in late embryogenesis-defective Arabidopsis mutants.1998 · DOI: 10.1023/a:1006011002499
`At4g37260`	Transcription factor that functions in salt stress response.	Loss of the R2R3 MYB, AtMyb73, causes hyper-induction of the SOS1 and SOS3 genes in response to high salinity in Arabidopsis.2013 · DOI: 10.1016/j.jplph.2013.05.011
`At3g50060`	Transcription factor involved in auxin response.	The Arabidopsis transcription factor MYB77 modulates auxin signal transduction.2007 · DOI: 10.1105/tpc.107.050963
`At3g09230`	Transcription factor MYB1.	No verified direct reference in this release
`At2g39880`	Required for male gametophyte (pollen) development.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013573 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009408 response to heat Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009555 pollen development Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0010929 positive regulation of auxin mediated signaling pathway Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

KEGG gene cross-reference

ath:AT2G39880

ath:AT3G09230

ath:AT3G50060

ath:AT4G37260

ath:AT5G67300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.892

Rank 1 · LXL04_013573 · OH-1004

Cytoplasm0.246

Rank 2 · LXL04_013573 · OH-1004

Mitochondrion0.022

Rank 3 · LXL04_013573 · OH-1004

Cell membrane0.018

Rank 4 · LXL04_013573 · OH-1004

Endoplasmic reticulum0.009

Rank 5 · LXL04_013573 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249.38Myb_DNA-binding5-51 aa

PF13921.13Myb_DNA-bind_68-66 aa

PF00249.38Myb_DNA-binding59-101 aa

PF13921.13Myb_DNA-bind_660-108 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013573	`PF00249.38`	Myb_DNA-binding	5	51	2.6e-39	133.8
LXL04_013573	`PF13921.13`	Myb_DNA-bind_6	8	66	4.3e-29	101.2
LXL04_013573	`PF00249.38`	Myb_DNA-binding	59	101	2.6e-39	133.8
LXL04_013573	`PF13921.13`	Myb_DNA-bind_6	60	108	4.3e-29	101.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FDW1`	Arabidopsis thaliana	Transcription factor MYB44	51.429%	Swiss-Prot	strong database homology
`O23160`	Arabidopsis thaliana	Transcription factor MYB73	47.853%	Swiss-Prot	moderate database homology
`Q9SN12`	Arabidopsis thaliana	Transcription factor MYB77	60.092%	Swiss-Prot	moderate database homology
`Q42575`	Arabidopsis thaliana	Transcription factor MYB1	48.235%	Swiss-Prot	moderate database homology
`O04192`	Arabidopsis thaliana	Transcription factor MYB25	46.927%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card