TkA06G072480 | RubberDandelionOmics

Gene overview

TkA06G072480

Reference: TK1151 Chr: Chr06 Coordinates: 19438546-19443059 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4409 bp · TkA06G072480|TK1151|cDNA

AAATTGTCCGGTAAGAAGCCACCCTACAATTTAAGCAAACACATCGAAAAACAAATGGAAATCGCACAACTGCTTTCATTGAAATTGTCAGCAAATAAACCAAACAGGCAATTTACCAAATCCAAAACGCTGTAATCCAAAACAAAAACCGTACTAACAAATTCCTCCAATTTCCTTCACCTTCTTCCTCCTAAAACCTTCCTCTCTGCATTTCAATGGCCGCCACAATCCAATTTCTGCCATTTTTGTTCCTTTTCTTC...

CDS

Download CDS FASTA

2328 bp · TkA06G072480|TK1151|CDS

ATGGCCGCCACAATCCAATTTCTGCCATTTTTGTTCCTTTTCTTCTTGCTTTCTTCTTCTTTCATACCTCAATCATCTTCAAACCTCACCCCTCAAAACATTCAGGTCTTTTATCCCTCCACACTTCCTCCTCCGCCTCCACCTCCTCCTCTTCCACCGCCGGAAACTACACCCATTGATACTCCCACCACCACCACTCCCACCCCGACCCCCACCACCACCACCGCCCCGACATCAAAATCAAGTAACAAAACCGTTGC...

Protein

Download Protein FASTA

775 aa · TkA06G072480|TK1151|PROTEIN

MAATIQFLPFLFLFFLLSSSFIPQSSSNLTPQNIQVFYPSTLPPPPPPPPLPPPETTPIDTPTTTTPTPTPTTTTAPTSKSSNKTVATAVAATAASTLVLSGLFFLLLVRYKRYRKIKETEKEKEIPGGNDNSNNQNPGVSLMNHFARVEGIKGVIVDEEGLDVLYWKNLEDDEPKKSIFKKEIPRINEKEEEKKIMMVDHGSRRKSNMQIQEVPLLRGKSSASHVWPSEDEIKIENSYNLPVAIANQEVLKSRLSSRSP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G072480`
TK1151 ID	TkA06G072480
OH-1004 ID	LXL04_025238
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G072480

Location Chr06:19438546-19443059 (+)

Description Similar to FH8: Formin-like protein 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g24150`	Might be involved in the organization and polarity of the actin cytoskeleton.	No verified direct reference in this release
`At1g70140`	Might be involved in the organization and polarity of the actin cytoskeleton.	No verified direct reference in this release
`At1g59910`	Might be involved in the organization and polarity of the actin cytoskeleton.	No verified direct reference in this release
`UniProt: O23373`	Acts as actin nucleation factor that directs the formation of actin cables and polarized growth in pollen tubes.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0739100`	Formin-like protein 16.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025238 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009932 cell tip growth Biological Process

GO:0030036 actin cytoskeleton organization Biological Process

GO:0030041 actin filament polymerization Biological Process

GO:0045010 actin nucleation Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G24150

ath:AT1G59910

ath:AT1G70140

dosa:Os02g0739100

dosa:Os03g0204100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.714

Rank 1 · TkA06G072480 · TK1151

Nucleus0.185

Rank 2 · TkA06G072480 · TK1151

Cytoplasm0.171

Rank 3 · TkA06G072480 · TK1151

Endoplasmic reticulum0.055

Rank 4 · TkA06G072480 · TK1151

Plastid0.026

Rank 5 · TkA06G072480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02181FH2164-183 aa

PF02181FH2304-711 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G072480	`PF02181`	FH2	164	183	3.1e-99	333.3
TkA06G072480	`PF02181`	FH2	304	711	3.1e-99	333.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O48682`	Arabidopsis thaliana	sp\|O48682\|FH4_ARATH Formin-like protein 4	51.100%	Swiss-Prot	High
`O04532`	Arabidopsis thaliana	sp\|O04532\|FH8_ARATH Formin-like protein 8	49.000%	Swiss-Prot	Medium
`Q9XIE0`	Arabidopsis thaliana	sp\|Q9XIE0\|FH7_ARATH Formin-like protein 7	50.900%	Swiss-Prot	Medium
`O23373`	Arabidopsis thaliana	sp\|O23373\|FH3_ARATH Formin-like protein 3	39.400%	Swiss-Prot	Medium
`A3AB67`	Oryza sativa subsp. japonica	sp\|A3AB67\|FH16_ORYSJ Formin-like protein 16	52.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card