LXL04_025238 | RubberDandelionOmics

Gene overview

LXL04_025238

Reference: OH-1004 Chr: Chr05 Coordinates: 108402620-108405034 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2310 bp · LXL04_025238|LXL04_025238|OH1004|cDNA

ATGGCCGCCACAATCCAATTTCTGCCGTTTTTGTCCCTTTTCTTCttgctttcttcttctttcaTACCTCAATCATCTTCAAACTTCACCCCTCAAAACATTCAGGTCTTTTACCCCTTCACACTTCCTCCTCCGCCTCCACCTCCTCCTCTTCCACCGCCGGAAATTACACCCACTGATACTCCCACCACCACCAATCCCACCCCAACACccacaaccaccaccaccaccacaaaCCCACCGTCAAAGTCAAGTAACAA...

CDS

Download CDS FASTA

2310 bp · LXL04_025238|LXL04_025238|OH1004|CDS

ATGGCCGCCACAATCCAATTTCTGCCGTTTTTGTCCCTTTTCTTCTTGCTTTCTTCTTCTTTCATACCTCAATCATCTTCAAACTTCACCCCTCAAAACATTCAGGTCTTTTACCCCTTCACACTTCCTCCTCCGCCTCCACCTCCTCCTCTTCCACCGCCGGAAATTACACCCACTGATACTCCCACCACCACCAATCCCACCCCAACACCCACAACCACCACCACCACCACAAACCCACCGTCAAAGTCAAGTAACAA...

Protein

Download Protein FASTA

769 aa · LXL04_025238|LXL04_025238|OH1004|PROTEIN

MAATIQFLPFLSLFFLLSSSFIPQSSSNFTPQNIQVFYPFTLPPPPPPPPLPPPEITPTDTPTTTNPTPTPTTTTTTTNPPSKSSNKTVATAVAATAASTLVLSGLFFLLLVRYKRYRKIKETEKEKEIPGGNDNSNNQNPGVSLMNHFARVEGIKGVIVDEEGLDVLYWKNLEDDEPKKSIFKKEIPRINEKEEEKKIMMVDHGSRRKSNMQIQEVPLLRGKSSASHVWPSEDEIKIENSYNLPVANQEVLKSRLSSRS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025238`
TK1151 ID	TkA06G072480
OH-1004 ID	LXL04_025238
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025238

Location Chr05:108402620-108405034 (-)

Description Similar to FH8: Formin-like protein 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g70140`	Might be involved in the organization and polarity of the actin cytoskeleton.	No verified direct reference in this release
`At1g24150`	Might be involved in the organization and polarity of the actin cytoskeleton.	No verified direct reference in this release
`At1g59910`	Might be involved in the organization and polarity of the actin cytoskeleton.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0739100`	Formin-like protein 16.	No verified direct reference in this release
`Os03g0204100`	Formin-like protein 8.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025238 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009932 cell tip growth Biological Process

GO:0030036 actin cytoskeleton organization Biological Process

GO:0030041 actin filament polymerization Biological Process

GO:0045010 actin nucleation Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G24150

ath:AT1G59910

ath:AT1G70140

dosa:Os02g0739100

dosa:Os03g0204100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.727

Rank 1 · LXL04_025238 · OH-1004

Nucleus0.173

Rank 2 · LXL04_025238 · OH-1004

Cytoplasm0.162

Rank 3 · LXL04_025238 · OH-1004

Endoplasmic reticulum0.056

Rank 4 · LXL04_025238 · OH-1004

Plastid0.026

Rank 5 · LXL04_025238 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02181.29FH2298-705 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025238	`PF02181.29`	FH2	298	705	3.7e-99	333.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04532`	Arabidopsis thaliana	Formin-like protein 8	43.657%	Swiss-Prot	moderate database homology
`O48682`	Arabidopsis thaliana	Formin-like protein 4	43.899%	Swiss-Prot	moderate database homology
`Q9XIE0`	Arabidopsis thaliana	Formin-like protein 7	51.509%	Swiss-Prot	moderate database homology
`A3AB67`	Oryza sativa subsp. japonica	Formin-like protein 16	48.381%	Swiss-Prot	moderate database homology
`Q10Q99`	Oryza sativa subsp. japonica	Formin-like protein 8	39.252%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card