TkA06G068250 | RubberDandelionOmics

Gene overview

TkA06G068250

Reference: TK1151 Chr: Chr06 Coordinates: 18263171-18264914 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1248 bp · TkA06G068250|TK1151|cDNA

CAAAAACACCCCTTTCGACTTATCCGGAACTCAATCATCTCCCTTATAAAGAGACACACACCCACCACCTTTCCAAAACACTAAAAACCTCCATAACCAAAACCTCAACTCACCGAGTTGTAGAGAGAGAAACAACCGAGGCTGTCTAGAGAGAGAGAGAGAAACATGTCGAAAGAAGTGAGTGAAGCCGGAGAAACGGCGAGGAGGGACTATGTTGACCCACCGCCAGCTCCCCTCCTTGACATGGGGGAGCTCAAGCT...

CDS

Download CDS FASTA

840 bp · TkA06G068250|TK1151|CDS

ATGTCGAAAGAAGTGAGTGAAGCCGGAGAAACGGCGAGGAGGGACTATGTTGACCCACCGCCAGCTCCCCTCCTTGACATGGGGGAGCTCAAGCTGTGGTCGTTTTACAGAGCCTTAATTGCTGAGTTTGTCGCCACCCTACTCTTCCTGTACGTCACCGTCGCCACCGTCATCGGCTACAAAAAAGAAACCGACCCATGCGGCGGCGTCGGCCTTCTCGGAATCGCGTGGGCATTCGGTGGCATGATCTTCATCCTTGT...

Protein

Download Protein FASTA

279 aa · TkA06G068250|TK1151|PROTEIN

MSKEVSEAGETARRDYVDPPPAPLLDMGELKLWSFYRALIAEFVATLLFLYVTVATVIGYKKETDPCGGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVSYMIAQSLGAICGVGLVKAFMKSYFNDLGGGANSVAPGYNKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNEKVWDDQWIFWVGPFVGALAAAAYHQY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G068250`
TK1151 ID	TkA06G068250
OH-1004 ID	LXL04_013038
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	83.000
Protein coverage (%)	TK1151 98.925 / OH-1004 99.647 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G068250

Location Chr06:18263171-18264914 (+)

Description Similar to PIP2-2: Aquaporin PIP2-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g35100`	Water channel required to facilitate the transport of water across cell membrane.	Characterization of two new channel protein genes in Arabidopsis.1999 · DOI: 10.1016/s1016-8478(23)13513-8
`At2g16850`	Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0233400`	Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013038 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006833 water transport Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0048767 root hair elongation Biological Process

GO:0080170 hydrogen peroxide transmembrane transport Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0015250 water channel activity Molecular Function

KEGG gene cross-reference

ath:AT2G37170

ath:AT2G37180

ath:AT3G54820

ath:AT5G60660

dosa:Os02g0629200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.801

Rank 1 · TkA06G068250 · TK1151

Cytoplasm0.118

Rank 2 · TkA06G068250 · TK1151

Endoplasmic reticulum0.089

Rank 3 · TkA06G068250 · TK1151

Lysosome / Vacuole0.056

Rank 4 · TkA06G068250 · TK1151

Mitochondrion0.043

Rank 5 · TkA06G068250 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00230MIP29-258 aa

PF17336DUF536858-92 aa

PF17336DUF5368103-179 aa

PF17336DUF5368242-266 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G068250	`PF00230`	MIP	29	258	6.9e-83	278.5
TkA06G068250	`PF17336`	DUF5368	58	92	0.02	15.9
TkA06G068250	`PF17336`	DUF5368	103	179	0.02	15.9
TkA06G068250	`PF17336`	DUF5368	242	266	0.02	15.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P93004`	Arabidopsis thaliana	sp\|P93004\|PIP27_ARATH Aquaporin PIP2-7	89.300%	Swiss-Prot	High
`Q9ZVX8`	Arabidopsis thaliana	sp\|Q9ZVX8\|PIP28_ARATH Probable aquaporin PIP2-8	88.900%	Swiss-Prot	High
`Q7XLR1`	Oryza sativa subsp. japonica	sp\|Q7XLR1\|PIP26_ORYSJ Probable aquaporin PIP2-6	83.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card