LXL04_013038 | RubberDandelionOmics

Gene overview

LXL04_013038

Reference: OH-1004 Chr: Chr03 Coordinates: 22876450-22878372 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

981 bp · LXL04_013038|LXL04_013038|OH1004|cDNA

ATAGTTCAACTCTATCTCCCTCACTATCCCCATAAATACCAGGCTTTCAACACCACACACTCCACACCAAACACCAGTTTAATTACTTCTCTCTCTAAAAACCCTATCCAGTCTCGATATTCCGCAGCCatgacaaaagacgttgaagTGGCGGAGCACCACGGCGGCAAAGACTACCACGACCCACCTCCGGCACCATTTTTCGACGCCGAAGAGCTCACCAAATGGTCTTTCTACAGAGCTGTCATCGCCGAATTCGT...

CDS

Download CDS FASTA

852 bp · LXL04_013038|LXL04_013038|OH1004|CDS

ATGACAAAAGACGTTGAAGTGGCGGAGCACCACGGCGGCAAAGACTACCACGACCCACCTCCGGCACCATTTTTCGACGCCGAAGAGCTCACCAAATGGTCTTTCTACAGAGCTGTCATCGCCGAATTCGTCGCCACCCTCCTCTTCCTTTACGTTACCGTCTTGACAGTCATCGGCTACAAGAGCCAGACTGACCCGGCCTTAAACCTCGACGAATGCGGCGGCGTCGGCATCCTCGGCATCGCCTGGGCCTTCGGTGG...

Protein

Download Protein FASTA

283 aa · LXL04_013038|LXL04_013038|OH1004|PROTEIN

MTKDVEVAEHHGGKDYHDPPPAPFFDAEELTKWSFYRAVIAEFVATLLFLYVTVLTVIGYKSQTDPALNLDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMIAQCLGAICGVGLVKAFQSSYYNRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNAKAWDDQWIFWVGPFIGAAIA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013038`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013038

Location Chr03:22876450-22878372 (-)

Description Similar to PIP2-2: Aquaporin PIP2-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g37170`	Water channel required to facilitate the transport of water across cell membrane.	No verified direct reference in this release
`At5g60660`	Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.	No verified direct reference in this release
`At3g54820`	Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.	No verified direct reference in this release
`At2g37180`	Water channel required to facilitate the transport of water across cell membrane; mercury-insensitive.	The plasma membrane of Arabidopsis thaliana contains a mercury-insensitive aquaporin that is a homolog of the tonoplast water channel protein TIP.1994 · DOI: 10.1104/pp.106.4.1325

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0629200`	Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013038 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006833 water transport Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0048767 root hair elongation Biological Process

GO:0080170 hydrogen peroxide transmembrane transport Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0015250 water channel activity Molecular Function

KEGG gene cross-reference

ath:AT2G37170

ath:AT2G37180

ath:AT3G54820

ath:AT5G60660

dosa:Os02g0629200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.689

Rank 1 · LXL04_013038 · OH-1004

Endoplasmic reticulum0.119

Rank 2 · LXL04_013038 · OH-1004

Lysosome / Vacuole0.118

Rank 3 · LXL04_013038 · OH-1004

Cytoplasm0.108

Rank 4 · LXL04_013038 · OH-1004

Golgi apparatus0.051

Rank 5 · LXL04_013038 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00230.26MIP29-264 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013038	`PF00230.26`	MIP	29	264	1.6e-85	287.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P43287`	Arabidopsis thaliana	Aquaporin PIP2-2	86.572%	Swiss-Prot	strong database homology
`Q9FF53`	Arabidopsis thaliana	Probable aquaporin PIP2-4	85.159%	Swiss-Prot	strong database homology
`Q9SV31`	Arabidopsis thaliana	Probable aquaporin PIP2-5	83.746%	Swiss-Prot	strong database homology
`P30302`	Arabidopsis thaliana	Aquaporin PIP2-3	85.512%	Swiss-Prot	strong database homology
`Q6K215`	Oryza sativa subsp. japonica	Probable aquaporin PIP2-2	83.391%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card