TkA06G062320 | RubberDandelionOmics

Gene overview

TkA06G062320

Reference: TK1151 Chr: Chr06 Coordinates: 16818957-16829944 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1325 bp · TkA06G062320|TK1151|cDNA

CTCACATTCCCTAGTCTCCTTCTCTCCCCTTTATGTAGTATTTATAATTCTTGGAAGCAATTCTCAATGATATCGGTTCAAAAAAGAAATTTATTTATCGGTCTAAAGAATGGAAGAGCTCGGGGTGGGCCTTGTATCGTTGCTACGAACAGCATGGATCGTTATTACTTTGCCGATTGTTGTAGGCCTTCATCCATTGCCTGGCCTTCGTTGGCTTCACACAACTCTCTCACAAATTTCTGAGAGGGGCAAAATTGTCC...

CDS

Download CDS FASTA

1044 bp · TkA06G062320|TK1151|CDS

ATGTCAGAAATTCTGTATCTCAGAATGGAAGAGTTGGAGCTAGGGCTTGTATCATTGCTACGAGCATCATGGATCCTTGCAACTGTACCGATTATCATAGCCTGTTTGCCTTTACCTGGACTTGGTTGGTTTCGCAAAATTCTCTTAGGGTTTGCTAAAAGAGGCAAGATTCTGCAATCCAACTCCAAACTAACTGTACCTCAAAGATTCTTCTCTCACTTCTACGTGGTGGCCATTTTCTGGACAACAATATTGCTAAT...

Protein

Download Protein FASTA

347 aa · TkA06G062320|TK1151|PROTEIN

MSEILYLRMEELELGLVSLLRASWILATVPIIIACLPLPGLGWFRKILLGFAKRGKILQSNSKLTVPQRFFSHFYVVAIFWTTILLIAVWLYAIRMLPSLIEQDMFSTITSHLTGGSQAFPLSKSLSTKEHVYNVWLSVFLLLLMEVQVVRRFYETIYVFNYSPSARMHIFGYLAGLFFYTAAPLSMCCSFAPEVLNFVKNMVAEFIVKGKDRMLRHEVNVWMFVTPFLKLPWFAWLGAAIFLWGWVHQLRCHEILGSLR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G062320`
TK1151 ID	TkA06G062320
OH-1004 ID	LXL04_025385
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.700
Protein coverage (%)	TK1151 97.118 / OH-1004 53.155 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G062320

Location Chr06:16818957-16829944 (-)

Description Similar to PPRD2: Polyprenol reductase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g16530`	Plays a key role in early steps of protein N-linked glycosylation by being involved in the conversion of polyprenol into dolichol.	POLYPRENOL REDUCTASE2 Deficiency Is Lethal in Arabidopsis Due to Male Sterility.2015 · DOI: 10.1105/tpc.15.00463
`At1g72590`	Plays a key role in early steps of protein N-linked glycosylation by being involved in the conversion of polyprenol into dolichol.	POLYPRENOL REDUCTASE2 Deficiency Is Lethal in Arabidopsis Due to Male Sterility.2015 · DOI: 10.1105/tpc.15.00463

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XWN6`	Plays a key role in early steps of protein N-linked glycosylation by being involved in the conversion of polyprenol into dolichol (By similarity).	No verified direct reference in this release
`Os04g0576800`	Plays a key role in early steps of protein N-linked glycosylation by being involved in the conversion of polyprenol into dolichol (By similarity).	No verified direct reference in this release
`Os07g0493400`	Plays a key role in early steps of protein N-linked glycosylation by being involved in the conversion of polyprenol into dolichol (By similarity).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025385 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016093 polyprenol metabolic process Biological Process

GO:0043048 dolichyl monophosphate biosynthetic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0003865 3-oxo-5-alpha-steroid 4-dehydrogenase activity Molecular Function

GO:0016229 steroid dehydrogenase activity Molecular Function

GO:0160198 polyprenal reductase activity Molecular Function

KEGG gene cross-reference

ath:AT1G72590

ath:AT2G16530

dosa:Os04g0576800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.696

Rank 1 · TkA06G062320 · TK1151

Golgi apparatus0.149

Rank 2 · TkA06G062320 · TK1151

Nucleus0.115

Rank 3 · TkA06G062320 · TK1151

Cytoplasm0.086

Rank 4 · TkA06G062320 · TK1151

Cell membrane0.081

Rank 5 · TkA06G062320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02544Steroid_dh69-97 aa

PF04191PEMT80-107 aa

PF04191PEMT145-199 aa

PF02544Steroid_dh233-347 aa

PF04191PEMT270-324 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G062320	`PF02544`	Steroid_dh	69	97	4.6e-23	82.6
TkA06G062320	`PF04191`	PEMT	80	107	0.31	12.2
TkA06G062320	`PF04191`	PEMT	145	199	0.31	12.2
TkA06G062320	`PF02544`	Steroid_dh	233	347	4.6e-23	82.6
TkA06G062320	`PF04191`	PEMT	270	324	0.31	12.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SI62`	Arabidopsis thaliana	sp\|Q9SI62\|PPRD2_ARATH Polyprenal reductase 2	55.400%	Swiss-Prot	High
`Q9CAH5`	Arabidopsis thaliana	sp\|Q9CAH5\|PPRD1_ARATH Polyprenal reductase 1	51.600%	Swiss-Prot	High
`A2XWN6`	Oryza sativa subsp. indica	sp\|A2XWN6\|PPRD1_ORYSI Polyprenal reductase 1	53.500%	Swiss-Prot	High
`Q7XUH5`	Oryza sativa subsp. japonica	sp\|Q7XUH5\|PPRD1_ORYSJ Polyprenal reductase 1	53.500%	Swiss-Prot	High
`Q7F0Q2`	Oryza sativa subsp. japonica	sp\|Q7F0Q2\|PPRD2_ORYSJ Polyprenal reductase 2	52.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card