LXL04_025385 | RubberDandelionOmics

Gene overview

LXL04_025385

Reference: OH-1004 Chr: Chr05 Coordinates: 110900849-110910695 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1905 bp · LXL04_025385|LXL04_025385|OH1004|cDNA

ATGTCAGAAATTCTGTATCTCAGAATGGAAGAGTTGGAGCTAGGGCTTGTATCATTGCTACGAGCATCATGGATCCTTGCAACTGTACCGATTATCATAGCCTGTTTGCCTTTACCTGGACTTGGTTGGTTTCGCAAAATTCTCTTAGGGTTTGCTAAAAGAGGCAAGATTCTGCAATCCAACTCCAAACTAACTGTACCTCAAAGATTCTTCTCTCACTTCTACGTGGTGGCCATTTTCTGGACAACAATATTGCTAAT...

CDS

Download CDS FASTA

1905 bp · LXL04_025385|LXL04_025385|OH1004|CDS

ATGTCAGAAATTCTGTATCTCAGAATGGAAGAGTTGGAGCTAGGGCTTGTATCATTGCTACGAGCATCATGGATCCTTGCAACTGTACCGATTATCATAGCCTGTTTGCCTTTACCTGGACTTGGTTGGTTTCGCAAAATTCTCTTAGGGTTTGCTAAAAGAGGCAAGATTCTGCAATCCAACTCCAAACTAACTGTACCTCAAAGATTCTTCTCTCACTTCTACGTGGTGGCCATTTTCTGGACAACAATATTGCTAAT...

Protein

Download Protein FASTA

634 aa · LXL04_025385|LXL04_025385|OH1004|PROTEIN

MSEILYLRMEELELGLVSLLRASWILATVPIIIACLPLPGLGWFRKILLGFAKRGKILQSNSKLTVPQRFFSHFYVVAIFWTTILLIAVWLYAIRMLPSLIEQDMFSTITSHLTGGSQAFPLSKSLSTKEHVYNVWLSVFLLLLMEVQVVRRFYETIYVFNYSPSARMHIFGYLAGLFFYTAAPLSMCCSFAPEVLNFVKNMVAEFIVKGKDRMLRHEVNVWMFVTPFLKLPWFAWLGAAIFLWGWVHQLRCHEILGSLR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025385`
TK1151 ID	TkA06G062320
OH-1004 ID	LXL04_025385
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.700
Protein coverage (%)	TK1151 97.118 / OH-1004 53.155 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025385

Location Chr05:110900849-110910695 (+)

Description Similar to PPRD2: Polyprenol reductase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g16530`	Plays a key role in early steps of protein N-linked glycosylation by being involved in the conversion of polyprenol into dolichol.	POLYPRENOL REDUCTASE2 Deficiency Is Lethal in Arabidopsis Due to Male Sterility.2015 · DOI: 10.1105/tpc.15.00463
`At1g72590`	Plays a key role in early steps of protein N-linked glycosylation by being involved in the conversion of polyprenol into dolichol.	POLYPRENOL REDUCTASE2 Deficiency Is Lethal in Arabidopsis Due to Male Sterility.2015 · DOI: 10.1105/tpc.15.00463

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0576800`	Plays a key role in early steps of protein N-linked glycosylation by being involved in the conversion of polyprenol into dolichol (By similarity).	No verified direct reference in this release
`UniProt: A2XWN6`	Plays a key role in early steps of protein N-linked glycosylation by being involved in the conversion of polyprenol into dolichol (By similarity).	No verified direct reference in this release
`Os07g0493400`	Plays a key role in early steps of protein N-linked glycosylation by being involved in the conversion of polyprenol into dolichol (By similarity).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025385 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016093 polyprenol metabolic process Biological Process

GO:0043048 dolichyl monophosphate biosynthetic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0003865 3-oxo-5-alpha-steroid 4-dehydrogenase activity Molecular Function

GO:0016229 steroid dehydrogenase activity Molecular Function

GO:0160198 polyprenal reductase activity Molecular Function

KEGG gene cross-reference

ath:AT1G72590

ath:AT2G16530

dosa:Os04g0576800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.560

Rank 1 · LXL04_025385 · OH-1004

Golgi apparatus0.172

Rank 2 · LXL04_025385 · OH-1004

Cell membrane0.161

Rank 3 · LXL04_025385 · OH-1004

Cytoplasm0.131

Rank 4 · LXL04_025385 · OH-1004

Lysosome / Vacuole0.088

Rank 5 · LXL04_025385 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02544.22Steroid_dh233-337 aa

PF02544.22Steroid_dh518-634 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025385	`PF02544.22`	Steroid_dh	233	337	8.6e-41	140.1
LXL04_025385	`PF02544.22`	Steroid_dh	518	634	8.6e-41	140.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SI62`	Arabidopsis thaliana	Polyprenal reductase 2	54.683%	Swiss-Prot	moderate database homology
`Q9CAH5`	Arabidopsis thaliana	Polyprenal reductase 1	51.515%	Swiss-Prot	moderate database homology
`Q7XUH5`	Oryza sativa subsp. japonica	Polyprenal reductase 1	51.917%	Swiss-Prot	moderate database homology
`A2XWN6`	Oryza sativa subsp. indica	Polyprenal reductase 1	51.917%	Swiss-Prot	moderate database homology
`Q7F0Q2`	Oryza sativa subsp. japonica	Polyprenal reductase 2	51.032%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card