TkA06G059370 | RubberDandelionOmics

Gene overview

TkA06G059370

Reference: TK1151 Chr: Chr06 Coordinates: 16023353-16026848 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2723 bp · TkA06G059370|TK1151|cDNA

ATAACTTATATCTCATTAATATGTATCCTTCAAATTTTCTGCAAATGAAGATATGAGAAGCGTAGTATTATAATAAAAGCATGATGCTAATAGCTTCTCATCTCTTTTTCTTTTTCTTTTTCTTTTTCTCTTCCATTCCTTCTCTCTCATCAGGAGCTGATACTTTAGCTGTTAATCAATCTCTCTCTGGAAACCAGACACTTGTCTCTCTTACCGAAACCTTCGAACTGGGTTTCTTTAAACCAGGTCAATCTCCCAAC...

CDS

Download CDS FASTA

2478 bp · TkA06G059370|TK1151|CDS

ATGATGCTAATAGCTTCTCATCTCTTTTTCTTTTTCTTTTTCTTTTTCTCTTCCATTCCTTCTCTCTCATCAGGAGCTGATACTTTAGCTGTTAATCAATCTCTCTCTGGAAACCAGACACTTGTCTCTCTTACCGAAACCTTCGAACTGGGTTTCTTTAAACCAGGTCAATCTCCCAACTATTACATTGCAATTTGGTACAAGAAAGTCAAAACATTTCCTCAAACCGCAGTCTGGGTAGCAAACAGAGAGACACCCAT...

Protein

Download Protein FASTA

825 aa · TkA06G059370|TK1151|PROTEIN

MMLIASHLFFFFFFFFSSIPSLSSGADTLAVNQSLSGNQTLVSLTETFELGFFKPGQSPNYYIAIWYKKVKTFPQTAVWVANRETPISDTFSSKLQIVNGNLVLLDESNTQIWSTNVPPTPATSASVVLLDNGNLVLRHDPNSTTPIWQSFDYPTHTFLPGGKVGYNKKTNRTQIITSWKSSEDPASGLFSLEIDQNVNQYLLLWNRSQVYRASGPWDGKTFSSMPEMRYNDVNNFSYIDNENESYFTYSLYNPSLTTRF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G059370`
TK1151 ID	TkA06G059370
OH-1004 ID	LXL04_025435
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.500
Protein coverage (%)	TK1151 98.424 / OH-1004 52.286 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G059370

Location Chr06:16023353-16026848 (-)

Description Similar to At4g03230: G-type lectin S-receptor-like serine/threonine-protein kinase At4g03230

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g03230`	G-type lectin S-receptor-like serine/threonine-protein kinase At4g03230.	No verified direct reference in this release
`At4g21380`	Involved in the regulation of cellular expansion and differentiation.	No verified direct reference in this release
`At4g27290`	G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290.	No verified direct reference in this release
`At1g65790`	Involved in the regulation of cellular expansion and differentiation.	No verified direct reference in this release
`At1g65800`	Involved in the regulation of cellular expansion and differentiation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025435 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006955 immune response Biological Process

GO:0007165 signal transduction Biological Process

GO:0048544 recognition of pollen Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004675 transmembrane receptor protein serine/threonine kinase activity Molecular Function

GO:0005516 calmodulin binding Molecular Function

KEGG gene cross-reference

ath:AT4G03230

ath:AT4G21380

ath:AT4G27290

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.854

Rank 1 · TkA06G059370 · TK1151

Endoplasmic reticulum0.085

Rank 2 · TkA06G059370 · TK1151

Cytoplasm0.069

Rank 3 · TkA06G059370 · TK1151

Nucleus0.039

Rank 4 · TkA06G059370 · TK1151

Lysosome / Vacuole0.028

Rank 5 · TkA06G059370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01453B_lectin76-180 aa

PF00954S_locus_glycop214-320 aa

PF11883DUF3403347-356 aa

PF08276PAN_2371-402 aa

PF07714PK_Tyr_Ser-Thr512-725 aa

PF00069Pkinase512-719 aa

PF01636APH620-657 aa

PF17667Pkinase_fungal629-702 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G059370	`PF01453`	B_lectin	76	180	2.2e-34	118.8
TkA06G059370	`PF00954`	S_locus_glycop	214	320	2.6e-27	96.2
TkA06G059370	`PF11883`	DUF3403	347	356	0.0091	16.8
TkA06G059370	`PF08276`	PAN_2	371	402	0.0037	18.0
TkA06G059370	`PF07714`	PK_Tyr_Ser-Thr	512	725	2.1e-45	155.8
TkA06G059370	`PF00069`	Pkinase	512	719	6.3e-43	147.8
TkA06G059370	`PF01636`	APH	620	657	0.07	13.6
TkA06G059370	`PF17667`	Pkinase_fungal	629	702	0.088	12.2
TkA06G059370	`PF11883`	DUF3403	787	825	0.0091	16.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZR08`	Arabidopsis thaliana	sp\|Q9ZR08\|Y4230_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At4g03230	45.500%	Swiss-Prot	Medium
`O81905`	Arabidopsis thaliana	sp\|O81905\|SD18_ARATH Receptor-like serine/threonine-protein kinase SD1-8	41.500%	Swiss-Prot	Medium
`O81832`	Arabidopsis thaliana	sp\|O81832\|Y4729_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290	42.200%	Swiss-Prot	Medium
`Q39086`	Arabidopsis thaliana	sp\|Q39086\|SD17_ARATH Receptor-like serine/threonine-protein kinase SD1-7	40.200%	Swiss-Prot	Medium
`Q9S972`	Arabidopsis thaliana	sp\|Q9S972\|SD16_ARATH Receptor-like serine/threonine-protein kinase SD1-6	40.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card