LXL04_025435 | RubberDandelionOmics

Gene overview

LXL04_025435

Reference: OH-1004 Chr: Chr05 Coordinates: 111648797-111658512 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4662 bp · LXL04_025435|LXL04_025435|OH1004|cDNA

ATGATGCTAATAGCTTCTcatctctttttctttttctttttctttttctcttccATTCCTTCTCTCTCATCAGTAGCTGATACTTTAGCTGTGAATCAATCTCTCTCTGGAAACCAGACACTTGTCTCTCTTACCGAAACCTTCGAACTGGGTTTCTTTAAACCAGGTCAATCTCCCAACTATTACATTGCAATTTGGTACAAGAAAGTCAAAACAGTTCCTCAAACCGCAGTCTGGGTAGCAAACAGAGAGACACCCAT...

CDS

Download CDS FASTA

4662 bp · LXL04_025435|LXL04_025435|OH1004|CDS

ATGATGCTAATAGCTTCTCATCTCTTTTTCTTTTTCTTTTTCTTTTTCTCTTCCATTCCTTCTCTCTCATCAGTAGCTGATACTTTAGCTGTGAATCAATCTCTCTCTGGAAACCAGACACTTGTCTCTCTTACCGAAACCTTCGAACTGGGTTTCTTTAAACCAGGTCAATCTCCCAACTATTACATTGCAATTTGGTACAAGAAAGTCAAAACAGTTCCTCAAACCGCAGTCTGGGTAGCAAACAGAGAGACACCCAT...

Protein

Download Protein FASTA

1553 aa · LXL04_025435|LXL04_025435|OH1004|PROTEIN

MMLIASHLFFFFFFFFSSIPSLSSVADTLAVNQSLSGNQTLVSLTETFELGFFKPGQSPNYYIAIWYKKVKTVPQTAVWVANRETPIYDTFSSKLQIVNGNLVLLDESNTQIWSTNVPPTPATSASVVLLDNGNLVLRHDPNSTTPIWQSFDYPTHTFLPGGKVGYNKKTNRTQIITSWKSSEDPASGLFSLEIDQNVNQYLLLWNRSQVYRASGPWDGKTFSSMPEMRYNDVNNFSYIDNENESYFTYSLYNPSLTTRF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025435`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025435

Location Chr05:111648797-111658512 (+)

Description Similar to At4g03230: G-type lectin S-receptor-like serine/threonine-protein kinase At4g03230

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g03230`	G-type lectin S-receptor-like serine/threonine-protein kinase At4g03230.	No verified direct reference in this release
`At4g21380`	Involved in the regulation of cellular expansion and differentiation.	No verified direct reference in this release
`At4g27290`	G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290.	No verified direct reference in this release
`At1g65790`	Involved in the regulation of cellular expansion and differentiation.	No verified direct reference in this release
`At4g21390`	G-type lectin S-receptor-like serine/threonine-protein kinase B120.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025435 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006955 immune response Biological Process

GO:0007165 signal transduction Biological Process

GO:0048544 recognition of pollen Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004675 transmembrane receptor protein serine/threonine kinase activity Molecular Function

GO:0005516 calmodulin binding Molecular Function

KEGG gene cross-reference

ath:AT4G03230

ath:AT4G21380

ath:AT4G27290

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.695

Rank 1 · LXL04_025435 · OH-1004

Cytoplasm0.100

Rank 2 · LXL04_025435 · OH-1004

Endoplasmic reticulum0.087

Rank 3 · LXL04_025435 · OH-1004

Extracellular0.073

Rank 4 · LXL04_025435 · OH-1004

Lysosome / Vacuole0.062

Rank 5 · LXL04_025435 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01453.31B_lectin76-180 aa

PF00954.26S_locus_glycop214-320 aa

PF07714.24PK_Tyr_Ser-Thr512-725 aa

PF00069.32Pkinase512-719 aa

PF01453.31B_lectin828-932 aa

PF00954.26S_locus_glycop975-1030 aa

PF08276.18PAN_21076-1116 aa

PF07714.24PK_Tyr_Ser-Thr1240-1453 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025435	`PF01453.31`	B_lectin	76	180	1.6e-69	231.7
LXL04_025435	`PF00954.26`	S_locus_glycop	214	320	1.5e-40	138.9
LXL04_025435	`PF07714.24`	PK_Tyr_Ser-Thr	512	725	7.3e-93	311.3
LXL04_025435	`PF00069.32`	Pkinase	512	719	1.5e-86	290.8
LXL04_025435	`PF01453.31`	B_lectin	828	932	1.6e-69	231.7
LXL04_025435	`PF00954.26`	S_locus_glycop	975	1030	1.5e-40	138.9
LXL04_025435	`PF08276.18`	PAN_2	1076	1116	9.3e-08	32.8
LXL04_025435	`PF07714.24`	PK_Tyr_Ser-Thr	1240	1453	7.3e-93	311.3
LXL04_025435	`PF00069.32`	Pkinase	1240	1451	1.5e-86	290.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZR08`	Arabidopsis thaliana	G-type lectin S-receptor-like serine/threonine-protein kinase At4g03230	44.759%	Swiss-Prot	moderate database homology
`O81905`	Arabidopsis thaliana	Receptor-like serine/threonine-protein kinase SD1-8	42.002%	Swiss-Prot	moderate database homology
`O81832`	Arabidopsis thaliana	G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290	41.718%	Swiss-Prot	moderate database homology
`Q39086`	Arabidopsis thaliana	Receptor-like serine/threonine-protein kinase SD1-7	40.196%	Swiss-Prot	moderate database homology
`O81906`	Arabidopsis thaliana	G-type lectin S-receptor-like serine/threonine-protein kinase B120	40.521%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card