TkA06G056170 | RubberDandelionOmics

Gene overview

TkA06G056170

Reference: TK1151 Chr: Chr06 Coordinates: 15143196-15144898 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1114 bp · TkA06G056170|TK1151|cDNA

TAGTTCAAAAATTATACTATTAAAAAATTAAACTCGATACAGAAATGGGTCCCTTTTCATCTCTTATCCTGAAAAAGCTGTCAGCCGGAGAGAGATAGAGAGAGAGAGAGAGAGAGAGAGTAAAAGTTAACGAGAGGAGGGGAAAACAATAGCTGTAAAATTGTGCAGGGTTTTATAACACAGTTGCAGCTATAGGCTTGGCACTATACTGTGTGTACTATTTCATTTCTTGACTTTATCTTCTCCAATCCCTTCCCTAC...

CDS

Download CDS FASTA

570 bp · TkA06G056170|TK1151|CDS

ATGGCGTCTTTGAGAATGATGGGGGTTCTGTCGTTTCTTCTGGTTTTTTCAAGCTTCTTCGTCCTCTTCGTTAACTCCGATGACGGGGGGACATTGTTGGAGATAAAAAAGTCGTTTAGAGATGTGAATAATGTGCTTTATGACTGGACTGCTTCACCTTCTTCCGACTACTGTTCATGGCGAGGTGTTTCTTGTGATAATGTCACCTTCAATGTCGTTGCCCTTAATCTTTCAGGCTTGAATCTTGATGGGGAACTGTC...

Protein

Download Protein FASTA

189 aa · TkA06G056170|TK1151|PROTEIN

MASLRMMGVLSFLLVFSSFFVLFVNSDDGGTLLEIKKSFRDVNNVLYDWTASPSSDYCSWRGVSCDNVTFNVVALNLSGLNLDGELSPSIGELKGLLSIDLRANRVSGQIPDEIGDCSVLTNLDLSFNMLTGDIPFSISKLKQLELLILKNNQLIGPIPTTLSRIPNLKILDLAQNRLNGEIPRLIYLE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G056170`
TK1151 ID	TkA06G056170
OH-1004 ID	LXL04_017905
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 55.026 / OH-1004 10.612 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G056170

Location Chr06:15143196-15144898 (+)

Description Similar to ERECTA: LRR receptor-like serine/threonine-protein kinase ERECTA

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g26330`	May act as a receptor kinase with ERL1 and ERL2 to regulate shoot architecture and stomatal patterning.	KNAT1 and ERECTA regulate inflorescence architecture in Arabidopsis.2002 · DOI: 10.1105/tpc.010391 Novel as1 and as2 defects in leaf adaxial-abaxial polarity reveal the requirement for ASYMMETRIC LEAVES1 and 2 and ERECTA functions in specifying leaf adaxial identity.2003 · DOI: 10.1242/dev.00622 ERECTA, an LRR receptor-like kinase protein controlling development pleiotropically affects resistance to bacterial wilt.2003 · DOI: 10.1046/j.1365-313x.2003.01877.x Synergistic interaction of three ERECTA-family receptor-like kinases controls Arabidopsis organ growth and flower development by promoting cell proliferation.2004 · DOI: 10.1242/dev.01028 ERECTA is required for protection against heat-stress in the AS1/ AS2 pathway to regulate adaxial-abaxial leaf polarity in Arabidopsis.2004 · DOI: 10.1007/s00425-004-1248-z ERECTA receptor-like kinase and heterotrimeric G protein from Arabidopsis are required for resistance to the necrotrophic fungus Plectosphaerella cucumerina.2005 · DOI: 10.1111/j.1365-313x.2005.02440.x The ERECTA gene regulates plant transpiration efficiency in Arabidopsis.2005 · DOI: 10.1038/nature03835 Pedicel development in Arabidopsis thaliana: contribution of vascular positioning and the role of the BREVIPEDICELLUS and ERECTA genes.2005 · DOI: 10.1016/j.ydbio.2005.06.011 Interaction of auxin and ERECTA in elaborating Arabidopsis inflorescence architecture revealed by the activation tagging of a new member of the YUCCA family putative flavin monooxygenases.2005 · DOI: 10.1104/pp.105.063495 ABA is an essential signal for plant resistance to pathogens affecting JA biosynthesis and the activation of defenses in Arabidopsis.2007 · DOI: 10.1105/tpc.106.048041 Haploinsufficiency after successive loss of signaling reveals a role for ERECTA-family genes in Arabidopsis ovule development.2007 · DOI: 10.1242/dev.004788 Genetics of microenvironmental canalization in Arabidopsis thaliana.2007 · DOI: 10.1073/pnas.0701936104 A strong effect of growth medium and organ type on the identification of QTLs for phytate and mineral concentrations in three Arabidopsis thaliana RIL populations.2009 · DOI: 10.1093/jxb/erp084 Polymorphic genes of major effect: consequences for variation, selection and evolution in Arabidopsis thaliana.2009 · DOI: 10.1534/genetics.108.097030 The ERECTA Receptor-Like Kinase Regulates Cell Wall-Mediated Resistance to Pathogens in Arabidopsis thaliana.2009 · DOI: 10.1094/mpmi-22-8-0953 Direct interaction of ligand-receptor pairs specifying stomatal patterning.2012 · DOI: 10.1101/gad.179895.111 Regulation of inflorescence architecture by intertissue layer ligand-receptor communication between endodermis and phloem.2012 · DOI: 10.1073/pnas.1117537109 Regulation of plant vascular stem cells by endodermis-derived EPFL-family peptide hormones and phloem-expressed ERECTA-family receptor kinases.2013 · DOI: 10.1093/jxb/ert196 A receptor-like protein acts as a specificity switch for the regulation of stomatal development.2017 · DOI: 10.1101/gad.297580.117 The Arabidopsis ERECTA gene encodes a putative receptor protein kinase with extracellular leucine-rich repeats.1996 · DOI: 10.1105/tpc.8.4.735
`At5g62230`	Receptor kinase that regulates inflorescence architecture and organ shape as well as stomatal patterning, including density and clustering, together with ER and ERL2.	Synergistic interaction of three ERECTA-family receptor-like kinases controls Arabidopsis organ growth and flower development by promoting cell proliferation.2004 · DOI: 10.1242/dev.01028 Haploinsufficiency after successive loss of signaling reveals a role for ERECTA-family genes in Arabidopsis ovule development.2007 · DOI: 10.1242/dev.004788 Direct interaction of ligand-receptor pairs specifying stomatal patterning.2012 · DOI: 10.1101/gad.179895.111 Regulation of plant vascular stem cells by endodermis-derived EPFL-family peptide hormones and phloem-expressed ERECTA-family receptor kinases.2013 · DOI: 10.1093/jxb/ert196 A receptor-like protein acts as a specificity switch for the regulation of stomatal development.2017 · DOI: 10.1101/gad.297580.117

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0203800`	Receptor kinase involved in the regulation of thermotolerance.	No verified direct reference in this release
`Os02g0777400`	Receptor kinase that may be involved in the regulation of cell proliferation and cell growth.	No verified direct reference in this release
`Os06g0130100`	Receptor kinase involved in salt drought stress responses.	Receptor-like kinase OsSIK1 improves drought and salt stress tolerance in rice (Oryza sativa) plants.2010 · DOI: 10.1111/j.1365-313x.2010.04146.x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017905 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001558 regulation of cell growth Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009664 plant-type cell wall organization Biological Process

GO:0009944 polarity specification of adaxial/abaxial axis Biological Process

GO:0009965 leaf morphogenesis Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0010103 stomatal complex morphogenesis Biological Process

GO:0010148 transpiration Biological Process

GO:0010286 heat acclimation Biological Process

GO:0030155 regulation of cell adhesion Biological Process

GO:0042659 regulation of cell fate specification Biological Process

GO:0042742 defense response to bacterium Biological Process

KEGG gene cross-reference

ath:AT2G26330

ath:AT5G62230

dosa:Os02g0777400

dosa:Os06g0130100

dosa:Os06g0203800

osa:4340000

osa:4340427

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.702

Rank 1 · TkA06G056170 · TK1151

Endoplasmic reticulum0.104

Rank 2 · TkA06G056170 · TK1151

Cytoplasm0.062

Rank 3 · TkA06G056170 · TK1151

Extracellular0.043

Rank 4 · TkA06G056170 · TK1151

Lysosome / Vacuole0.042

Rank 5 · TkA06G056170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_226-66 aa

PF23211LRR_LRWD171-112 aa

PF13516LRR_672-79 aa

PF00560LRR_173-93 aa

PF25013LRR_Zer-174-87 aa

PF12799LRR_475-106 aa

PF23598LRR_1487-174 aa

PF13855LRR_889-130 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G056170	`PF08263`	LRRNT_2	26	66	2.5e-12	47.6
TkA06G056170	`PF23211`	LRR_LRWD1	71	112	0.0064	16.9
TkA06G056170	`PF13516`	LRR_6	72	79	0.18	12.6
TkA06G056170	`PF00560`	LRR_1	73	93	2.2e-13	48.2
TkA06G056170	`PF25013`	LRR_Zer-1	74	87	0.0045	17.9
TkA06G056170	`PF12799`	LRR_4	75	106	3.2e-07	31.1
TkA06G056170	`PF23598`	LRR_14	87	174	1.8e-05	24.4
TkA06G056170	`PF13855`	LRR_8	89	130	4.1e-09	36.8
TkA06G056170	`PF24048`	LRR_NXF1-5	95	155	0.035	14.5
TkA06G056170	`PF00560`	LRR_1	96	117	2.2e-13	48.2
TkA06G056170	`PF13516`	LRR_6	96	107	0.18	12.6
TkA06G056170	`PF23211`	LRR_LRWD1	111	176	0.0064	16.9
TkA06G056170	`PF13516`	LRR_6	117	132	0.18	12.6
TkA06G056170	`PF25013`	LRR_Zer-1	119	177	0.0045	17.9
TkA06G056170	`PF00560`	LRR_1	120	141	2.2e-13	48.2
TkA06G056170	`PF13855`	LRR_8	120	178	4.1e-09	36.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q42371`	Arabidopsis thaliana	sp\|Q42371\|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA	72.100%	Swiss-Prot	Medium
`C0LGW6`	Arabidopsis thaliana	sp\|C0LGW6\|ERL1_ARATH LRR receptor-like serine/threonine-protein kinase ERL1	52.700%	Swiss-Prot	Low
`Q69SP5`	Oryza sativa subsp. japonica	sp\|Q69SP5\|EREC1_ORYSJ LRR receptor-like serine/threonine-protein kinase ER1	71.800%	Swiss-Prot	Low
`I1Z695`	Oryza sativa subsp. japonica	sp\|I1Z695\|EREC2_ORYSJ LRR receptor-like serine/threonine-protein kinase ER2	69.700%	Swiss-Prot	Low
`Q658G7`	Oryza sativa subsp. japonica	sp\|Q658G7\|SIK1_ORYSJ LRR receptor-like serine/threonine-protein kinase SIK1	52.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card