TkA06G050980 | RubberDandelionOmics

Gene overview

TkA06G050980

Reference: TK1151 Chr: Chr06 Coordinates: 13851379-13854010 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2142 bp · TkA06G050980|TK1151|cDNA

TACCCTTTGGTCCCAATGATAGACTGAACTTAATATAAGAATTTTAGGCTATGGGAGTGGTTAGCGTGATAAGGGTGTGCTAAGAGATGCCACGTAGGATTTTTGGGCCTTAGCATTTCCTTAGCATTTAGGTGGGGAGTGGTTAGCGTGTGCTAAGTTAATTATTTTAGTGGAGAGAAGAGAAACAGGTACTGAATTTATACCCGTTACACACACACACGTTCGCTATAGCCTCGCTGAGGGGATAGCGAGGCATGCGA...

CDS

Download CDS FASTA

1143 bp · TkA06G050980|TK1151|CDS

ATGACGATGAAAGAGTGGAAATTCAAAGAGAATCAGAATTTAAAGACTGCATCAGCCTTTTCAATTAAACGTGTTCTTGACGATGTCAAGAACAACGTTAATCCAAGTGATGAAAGGCCCGTTATACCTCTCAGCCATGGAGATCCTTCATCGTTTTCATGCTTCCGAACTACTCAAGTAGCAGAAGATGCAGTAGTGGATGCTCTTTGCTCAGCTAACTTCAACGGTTATGCACCCAAAGGCGGCGCTCTTCAAGCAAG...

Protein

Download Protein FASTA

380 aa · TkA06G050980|TK1151|PROTEIN

MTMKEWKFKENQNLKTASAFSIKRVLDDVKNNVNPSDERPVIPLSHGDPSSFSCFRTTQVAEDAVVDALCSANFNGYAPKGGALQARRAIAEYLSINLPYELSTDDVYVTLGAKQAIEIVLSSLRRPGANILLPKPGYPAYDALSILNHIEVRHFDLLQEKTWEVDLEGVEKLADDKTVAMVIINPGNPCGNVFTHAHLQKIAETARRLGILVIADEAYAHLTFGRNSFVPMGVFGSIVPVLTLGSLSKRWIVPGWRLGW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G050980`
TK1151 ID	TkA06G050980
OH-1004 ID	LXL04_025571
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	95.000
Protein coverage (%)	TK1151 99.474 / OH-1004 90.865 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G050980

Location Chr06:13851379-13854010 (-)

Description Similar to NAAT1: Nicotianamine aminotransferase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g36160`	Transaminase involved in tyrosine breakdown.	Identification and Partial Characterization of an L-Tyrosine Aminotransferase (TAT) from Arabidopsis thaliana.2010 · DOI: 10.1155/2010/549572
`At5g53970`	Probable aminotransferase TAT2.	No verified direct reference in this release
`At2g20610`	C-S lyase involved in glucosinolate biosynthesis.	Arabidopsis mutants in the C-S lyase of glucosinolate biosynthesis establish a critical role for indole-3-acetaldoxime in auxin homeostasis.2004 · DOI: 10.1111/j.1365-313x.2004.02002.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0306401`	Involved in biosynthesis of mugineic acid family phytosiderophores, which are ferric iron chelators produced in graminaceous plants in response to iron deficiency.	Identification and localisation of the rice nicotianamine aminotransferase gene OsNAAT1 expression suggests the site of phytosiderophore synthesis in rice.2008 · DOI: 10.1007/s11103-007-9262-8

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025571 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001560 regulation of cell growth by extracellular stimulus Biological Process

GO:0006520 amino acid metabolic process Biological Process

GO:0006559 L-phenylalanine catabolic process Biological Process

GO:0006572 L-tyrosine catabolic process Biological Process

GO:0009684 indoleacetic acid biosynthetic process Biological Process

GO:0010189 vitamin E biosynthetic process Biological Process

GO:0019761 glucosinolate biosynthetic process Biological Process

GO:0048830 adventitious root development Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT2G20610

ath:AT5G36160

ath:AT5G53970

dosa:Os02g0306401

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.541

Rank 1 · TkA06G050980 · TK1151

Nucleus0.150

Rank 2 · TkA06G050980 · TK1151

Endoplasmic reticulum0.117

Rank 3 · TkA06G050980 · TK1151

Peroxisome0.089

Rank 4 · TkA06G050980 · TK1151

Mitochondrion0.067

Rank 5 · TkA06G050980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00155Aminotran_1_240-351 aa

PF00266Aminotran_5103-219 aa

PF01041DegT_DnrJ_EryC1115-222 aa

PF01053Cys_Met_Meta_PP115-219 aa

PF01212Beta_elim_lyase119-218 aa

PF00202Aminotran_3164-217 aa

PF25824DUF7951272-317 aa

PF30612PSI_PTTG1IP320-338 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G050980	`PF00155`	Aminotran_1_2	40	351	2e-46	159.6
TkA06G050980	`PF00266`	Aminotran_5	103	219	0.0003	20.6
TkA06G050980	`PF01041`	DegT_DnrJ_EryC1	115	222	0.029	14.3
TkA06G050980	`PF01053`	Cys_Met_Meta_PP	115	219	0.062	12.6
TkA06G050980	`PF01212`	Beta_elim_lyase	119	218	0.038	14.0
TkA06G050980	`PF00202`	Aminotran_3	164	217	0.28	10.6
TkA06G050980	`PF25824`	DUF7951	272	317	0.22	12.0
TkA06G050980	`PF30612`	PSI_PTTG1IP	320	338	0.14	13.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LVY1`	Arabidopsis thaliana	sp\|Q9LVY1\|TAT_ARATH Tyrosine aminotransferase	50.900%	Swiss-Prot	High
`Q9FN30`	Arabidopsis thaliana	sp\|Q9FN30\|TAT2_ARATH Probable aminotransferase TAT2	55.000%	Swiss-Prot	High
`Q9SIV0`	Arabidopsis thaliana	sp\|Q9SIV0\|SUR1_ARATH S-alkyl-thiohydroximate lyase SUR1	49.300%	Swiss-Prot	Medium
`A0A0P0VI36`	Oryza sativa subsp. japonica	sp\|A0A0P0VI36\|NAAT1_ORYSJ Nicotianamine aminotransferase 1	55.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card