TkA06G040270 | RubberDandelionOmics

Gene overview

TkA06G040270

Reference: TK1151 Chr: Chr06 Coordinates: 10881047-10882168 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1122 bp · TkA06G040270|TK1151|cDNA

ATGGATAACTCCTCCACGCCGACAGCCTCCGAGCAACCAATTCATGGCGATGTACTCGAGGCCATCCTCTCCCACGTCCCACTCGTCCACTTACTTCCAGCTTCCGGTGTCTCAAAGTCGTGGACAGCCGCCGTCTCATCGGCCCTTCGCACCTCCCCCAACACCAAACCATGGCTAATCGTCCACACGCAAAGCTCCAGGCACCCCTACCCGATAACCACGAACGCCTACGACCCGGAGTCAAACGTGTGGATCGAAAT...

CDS

Download CDS FASTA

1122 bp · TkA06G040270|TK1151|CDS

ATGGATAACTCCTCCACGCCGACAGCCTCCGAGCAACCAATTCATGGCGATGTACTCGAGGCCATCCTCTCCCACGTCCCACTCGTCCACTTACTTCCAGCTTCCGGTGTCTCAAAGTCGTGGACAGCCGCCGTCTCATCGGCCCTTCGCACCTCCCCCAACACCAAACCATGGCTAATCGTCCACACGCAAAGCTCCAGGCACCCCTACCCGATAACCACGAACGCCTACGACCCGGAGTCAAACGTGTGGATCGAAAT...

Protein

Download Protein FASTA

373 aa · TkA06G040270|TK1151|PROTEIN

MDNSSTPTASEQPIHGDVLEAILSHVPLVHLLPASGVSKSWTAAVSSALRTSPNTKPWLIVHTQSSRHPYPITTNAYDPESNVWIEIRHPAIDYVSILRSSQSNLLYMLSSTKLSLSFDPLHLTWHNAVAPKVSRIDPVVAVVGRHIVVAGGAYDFEDDPLAVEVYDLESQKWTKSDPMPEFFSGSASSLWLSVASVDPHLFVMEKSSGVTHSFDPSTNTWSGPYDLRPDHRVFNSVIGFSNDRLIVIGMLGDAEDVDGV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G040270`
TK1151 ID	TkA06G040270
OH-1004 ID	LXL04_022282
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	82.900
Protein coverage (%)	TK1151 98.660 / OH-1004 99.191 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G040270

Location Chr06:10881047-10882168 (+)

Description Similar to At1g23390: F-box/kelch-repeat protein At1g23390

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g23390`	F-box/kelch-repeat protein At1g23390.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022282 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000070 mitotic sister chromatid segregation Biological Process

GO:0006513 protein monoubiquitination Biological Process

GO:0007094 mitotic spindle assembly checkpoint signaling Biological Process

GO:0010507 negative regulation of autophagy Biological Process

GO:0030307 positive regulation of cell growth Biological Process

GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0051301 cell division Biological Process

GO:0071233 cellular response to L-leucine Biological Process

GO:1904263 positive regulation of TORC1 signaling Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G23390

ath:AT3G24760

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.519

Rank 1 · TkA06G040270 · TK1151

Cytoplasm0.458

Rank 2 · TkA06G040270 · TK1151

Cell membrane0.089

Rank 3 · TkA06G040270 · TK1151

Endoplasmic reticulum0.069

Rank 4 · TkA06G040270 · TK1151

Plastid0.050

Rank 5 · TkA06G040270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box17-47 aa

PF12937F-box-like17-47 aa

PF07646Kelch_270-86 aa

PF24681Kelch_KLHDC2_KLHL20_DRC773-88 aa

PF13964Beta-prop_Calicin74-89 aa

PF01344Kelch_176-87 aa

PF25210Kelch_FKB95117-222 aa

PF01344Kelch_1118-127 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G040270	`PF00646`	F-box	17	47	0.0021	18.6
TkA06G040270	`PF12937`	F-box-like	17	47	0.0094	16.4
TkA06G040270	`PF07646`	Kelch_2	70	86	4.6e-09	36.5
TkA06G040270	`PF24681`	Kelch_KLHDC2_KLHL20_DRC7	73	88	0.00015	21.9
TkA06G040270	`PF13964`	Beta-prop_Calicin	74	89	0.074	12.8
TkA06G040270	`PF01344`	Kelch_1	76	87	1.7e-05	24.9
TkA06G040270	`PF25210`	Kelch_FKB95	117	222	5.2e-09	36.8
TkA06G040270	`PF01344`	Kelch_1	118	127	1.7e-05	24.9
TkA06G040270	`PF24681`	Kelch_KLHDC2_KLHL20_DRC7	133	182	0.00015	21.9
TkA06G040270	`PF01344`	Kelch_1	137	180	1.7e-05	24.9
TkA06G040270	`PF07646`	Kelch_2	139	180	4.6e-09	36.5
TkA06G040270	`PF13415`	Beta-prop_FBX42	139	177	0.017	15.5
TkA06G040270	`PF13964`	Beta-prop_Calicin	140	177	0.074	12.8
TkA06G040270	`PF24681`	Kelch_KLHDC2_KLHL20_DRC7	141	274	0.00015	21.9
TkA06G040270	`PF13964`	Beta-prop_Calicin	158	238	0.074	12.8
TkA06G040270	`PF07893`	DUF1668	166	222	0.077	13.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LDE3`	Arabidopsis thaliana	sp\|Q9LDE3\|FBK9_ARATH F-box/kelch-repeat protein At1g23390	42.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card