TkA06G039830 | RubberDandelionOmics

Gene overview

TkA06G039830

Reference: TK1151 Chr: Chr06 Coordinates: 10747796-10750440 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1920 bp · TkA06G039830|TK1151|cDNA

AAACGCTCAATCTTGCCGGTTTGGGAGGTGGTACGGAAATCATTCACAGGTTCGGGACCTGCTTTCTACTTCCCGGAAGCTCACCCTCAACCTCAGCTTTTCAGTCAGATGTTTGATCGGGATGGAGAACAGAAGACGGGGAAGAATTAGAGAGCCGACTCGTGTTTTTGGATAATTGGGGATTTTGTTGGTGAAATTGTGCATTAATAGATAGATGGAAACTAGGGGTCTAGGTCAACAGTACAATTTGAGGTCAACCG...

CDS

Download CDS FASTA

1305 bp · TkA06G039830|TK1151|CDS

ATGGGTACTAGGGTTCCGGTTCAACAATACAGCTTAAGATCGGCTGATTCATACATAGATTCGACTTCATTGCATGATCTGAACACTGTAGATGGGCGTGCTGGAGAGATTATTGAACCCATGGTTGACCGCAGTGCTGTTACTGATGAAAGCTTAGACAACGAAGACGAATCTGGTGCTGTTGAATGCATGCATGAAAGCTACCAGAATACATTACCACTTCATAATGTAGGCGTAGATGGAGGTCATTCAAGCCTTGA...

Protein

Download Protein FASTA

434 aa · TkA06G039830|TK1151|PROTEIN

MGTRVPVQQYSLRSADSYIDSTSLHDLNTVDGRAGEIIEPMVDRSAVTDESLDNEDESGAVECMHESYQNTLPLHNVGVDGGHSSLDSNGSSRDPYNILSPNDVLPIETARARFLDFIVDNFIGSHVVEVTDSETETISQSIEETANKRKEREIQYEGDSRYVLPLMYIANMYETLVNEVNIRLSSLDGMREKTIGVALEAAGGLYRKLAKKFPRKGSSTFKRRELATSFETRSRFPELVIQEEKRVRFVVVNGLDIMEK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G039830`
TK1151 ID	TkA06G039830
OH-1004 ID	LXL04_025853
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	93.800
Protein coverage (%)	TK1151 100.000 / OH-1004 40.053 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G039830

Location Chr06:10747796-10750440 (+)

Description Similar to At2g02150: Putative pentatricopeptide repeat-containing protein At2g02150

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g02148`	Uncharacterized protein At2g02148.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025853 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0090615 mitochondrial mRNA processing Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0036002 pre-mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G01740

ath:AT2G02148

ath:AT2G02150

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.530

Rank 1 · TkA06G039830 · TK1151

Nucleus0.326

Rank 2 · TkA06G039830 · TK1151

Cell membrane0.168

Rank 3 · TkA06G039830 · TK1151

Golgi apparatus0.080

Rank 4 · TkA06G039830 · TK1151

Lysosome / Vacuole0.074

Rank 5 · TkA06G039830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12773DZR389-428 aa

PF08772Zn_ribbon_NOB1404-420 aa

PF13240Zn_Ribbon_1406-415 aa

PF14803Zn_ribbon_Nudix407-416 aa

PF06677Auto_anti-p27407-428 aa

PF13240Zn_Ribbon_1408-428 aa

PF08772Zn_ribbon_NOB1408-432 aa

PF13248Zn_ribbon_3409-430 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G039830	`PF12773`	DZR	389	428	0.0029	18.4
TkA06G039830	`PF08772`	Zn_ribbon_NOB1	404	420	0.3	11.9
TkA06G039830	`PF13240`	Zn_Ribbon_1	406	415	0.0082	16.6
TkA06G039830	`PF14803`	Zn_ribbon_Nudix	407	416	0.049	14.3
TkA06G039830	`PF06677`	Auto_anti-p27	407	428	0.18	12.6
TkA06G039830	`PF13240`	Zn_Ribbon_1	408	428	0.0082	16.6
TkA06G039830	`PF08772`	Zn_ribbon_NOB1	408	432	0.3	11.9
TkA06G039830	`PF13248`	Zn_ribbon_3	409	430	0.011	16.0
TkA06G039830	`PF14803`	Zn_ribbon_Nudix	422	428	0.049	14.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q56XX3`	Arabidopsis thaliana	sp\|Q56XX3\|Y2215_ARATH Uncharacterized protein At2g02148	56.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card