TkA06G039810 | RubberDandelionOmics

Gene overview

TkA06G039810

Reference: TK1151 Chr: Chr06 Coordinates: 10742045-10743853 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1611 bp · TkA06G039810|TK1151|cDNA

ATGATTATAGCTGGTATTAAGCCTTCTGTATTCACATACAATATCATGATTGATTATCTGTGTAAAATAGGAGACATTGATGGTGCACAAAGATTCTACACAGAGATGAAAACATTAGGAATCACACCAGATATTGTTACTTACAACTCACTCATTGATGGATATGGTAAAAATGGAAAGTTATCCGAATCTATCTGTATATATAACGATATGAAGAACCTCCATTGTTACCCTGATGTCATCACATACAATGCATTGAT...

CDS

Download CDS FASTA

1611 bp · TkA06G039810|TK1151|CDS

ATGATTATAGCTGGTATTAAGCCTTCTGTATTCACATACAATATCATGATTGATTATCTGTGTAAAATAGGAGACATTGATGGTGCACAAAGATTCTACACAGAGATGAAAACATTAGGAATCACACCAGATATTGTTACTTACAACTCACTCATTGATGGATATGGTAAAAATGGAAAGTTATCCGAATCTATCTGTATATATAACGATATGAAGAACCTCCATTGTTACCCTGATGTCATCACATACAATGCATTGAT...

Protein

Download Protein FASTA

536 aa · TkA06G039810|TK1151|PROTEIN

MIIAGIKPSVFTYNIMIDYLCKIGDIDGAQRFYTEMKTLGITPDIVTYNSLIDGYGKNGKLSESICIYNDMKNLHCYPDVITYNALINCFCKFGQMPKAFEFLHFMKKSGLKPNVVTYTTFIDAFCKEGMMQEALKFFMDMRRVGLIPNEFTYTSLIDANCKAGCVHEAVKLIKEMNEANVMVNTVTCTALLDGLTKEGKMKEAELFFQEMVKTGISPNIKSYTTILHGHVKLKNKSEAMNVYEEMESKGLKPDLLLYGT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G039810`
TK1151 ID	TkA06G039810
OH-1004 ID	LXL04_025853
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 11.940 / OH-1004 5.634 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G039810`
Location	Chr06:10742045-10743853 (+)
Description	Similar to At2g02150: Putative pentatricopeptide repeat-containing protein At2g02150
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_025853` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0090615 mitochondrial mRNA processing Biological Process GO:0005739 mitochondrion Cellular Component GO:0009507 chloroplast Cellular Component GO:0036002 pre-mRNA binding Molecular Function
KEGG gene cross-reference	ath:AT2G01740 ath:AT2G02148 ath:AT2G02150 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.843

Rank 1 · TkA06G039810 · TK1151

Plastid0.061

Rank 2 · TkA06G039810 · TK1151

Nucleus0.057

Rank 3 · TkA06G039810 · TK1151

Cytoplasm0.053

Rank 4 · TkA06G039810 · TK1151

Cell membrane0.016

Rank 5 · TkA06G039810 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29070MSC6_N2-34 aa

PF08579RPM22-22 aa

PF13812PPR_33-58 aa

PF17177PPR_long3-121 aa

PF12854PPR_15-37 aa

PF10037MRP-S275-36 aa

PF23276TPR_247-51 aa

PF13041PPR_28-52 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G039810	`PF29070`	MSC6_N	2	34	3.9e-27	96.1
TkA06G039810	`PF08579`	RPM2	2	22	0.0012	19.9
TkA06G039810	`PF13812`	PPR_3	3	58	1.1e-69	231.1
TkA06G039810	`PF17177`	PPR_long	3	121	3.4e-42	144.9
TkA06G039810	`PF12854`	PPR_1	5	37	4.6e-129	420.5
TkA06G039810	`PF10037`	MRP-S27	5	36	1.3e-09	38.2
TkA06G039810	`PF23276`	TPR_24	7	51	3.5e-36	124.8
TkA06G039810	`PF13041`	PPR_2	8	52	6.6e-165	535.9
TkA06G039810	`PF01535`	PPR	11	41	1.9e-111	357.6
TkA06G039810	`PF19189`	Mtf2	12	49	0.12	12.8
TkA06G039810	`PF24760`	TPR_IF140_C	13	37	6e-06	27.4
TkA06G039810	`PF10602`	RPN7	16	38	0.017	15.6
TkA06G039810	`PF29978`	ATP18_TPR	17	52	0.0011	19.5
TkA06G039810	`PF07719`	TPR_2	20	35	0.15	13.0
TkA06G039810	`PF12514`	DUF3718	20	43	0.34	11.9
TkA06G039810	`PF29070`	MSC6_N	25	137	3.9e-27	96.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card