TkA06G034620 | RubberDandelionOmics

Gene overview

TkA06G034620

Reference: TK1151 Chr: Chr06 Coordinates: 9320421-9322570 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

535 bp · TkA06G034620|TK1151|cDNA

ATGGAGCGTGTTCACGATAATGTTAGAGGTGTAGTGGTACAAGAAGATAAATTGAGCAGCTTGCCAAATAACCTTATTCATAAGATTCTTTCTTTTTTTGACATAAAATTTGTTGTTCAAACGTCTTTATTGTCGTCAAGATGGAAGCTTCTCTGGACATCAATGCCTTATCTCAACTTCTCAACCGACCGTTTTCCTGATTTTCATAAATTTGACGAATTTGCGACTCATGTTTTGTCTCGCCGCAACCATCAATCAGA...

CDS

Download CDS FASTA

534 bp · TkA06G034620|TK1151|CDS

ATGGAGCGTGTTCACGATAATGTTAGAGGTGTAGTGGTACAAGAAGATAAATTGAGCAGCTTGCCAAATAACCTTATTCATAAGATTCTTTCTTTTTTTGACATAAAATTTGTTGTTCAAACGTCTTTATTGTCGTCAAGATGGAAGCTTCTCTGGACATCAATGCCTTATCTCAACTTCTCAACCGACCGTTTTCCTGATTTTCATAAATTTGACGAATTTGCGACTCATGTTTTGTCTCGCCGCAACCATCAATCAGA...

Protein

Download Protein FASTA

178 aa · TkA06G034620|TK1151|PROTEIN

MERVHDNVRGVVVQEDKLSSLPNNLIHKILSFFDIKFVVQTSLLSSRWKLLWTSMPYLNFSTDRFPDFHKFDEFATHVLSRRNHQSEVTSVKLDFGRAENLGFLKNIASYALSHNVQYLTIDGTAPRRGDDCPTCLFSSQSLKQFTLSCRFYPHPNTTITSLDFPALTTLNLAHIEVS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G034620`
TK1151 ID	TkA06G034620
OH-1004 ID	LXL04_025893
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.100
Protein coverage (%)	TK1151 100.000 / OH-1004 21.933 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G034620

Location Chr06:9320421-9322570 (+)

Description Similar to At4g03220: Putative F-box/FBD/LRR-repeat protein At4g03220

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g02920`	F-box/LRR-repeat protein 25.	No verified direct reference in this release
`At5g02910`	F-box/LRR-repeat protein At5g02910.	No verified direct reference in this release
`At1g49610`	Putative F-box protein At1g49610.	No verified direct reference in this release
`At3g56780`	Putative F-box/FBD/LRR-repeat protein At3g56780.	No verified direct reference in this release
`At5g25850`	Putative F-box/FBD/LRR-repeat protein At5g25850.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025893 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G13780

ath:AT1G78760

ath:AT3G26922

ath:AT4G03220

ath:AT5G02920

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.590

Rank 1 · TkA06G034620 · TK1151

Cytoplasm0.443

Rank 2 · TkA06G034620 · TK1151

Endoplasmic reticulum0.058

Rank 3 · TkA06G034620 · TK1151

Cell membrane0.045

Rank 4 · TkA06G034620 · TK1151

Extracellular0.028

Rank 5 · TkA06G034620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04755PAP_fibrillin4-58 aa

PF00646F-box18-56 aa

PF12937F-box-like18-51 aa

PF24758LRR_At5g56370113-178 aa

PF00646F-box132-152 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G034620	`PF04755`	PAP_fibrillin	4	58	0.23	12.1
TkA06G034620	`PF00646`	F-box	18	56	1e-07	32.2
TkA06G034620	`PF12937`	F-box-like	18	51	0.0056	17.1
TkA06G034620	`PF24758`	LRR_At5g56370	113	178	0.0011	19.4
TkA06G034620	`PF00646`	F-box	132	152	1e-07	32.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q1PE04`	Arabidopsis thaliana	sp\|Q1PE04\|FBL25_ARATH F-box/LRR-repeat protein 25	29.400%	Swiss-Prot	Low
`Q9LYZ4`	Arabidopsis thaliana	sp\|Q9LYZ4\|FBL79_ARATH F-box/LRR-repeat protein At5g02910	27.900%	Swiss-Prot	Low
`Q9FX89`	Arabidopsis thaliana	sp\|Q9FX89\|FB50_ARATH Putative F-box protein At1g49610	30.100%	Swiss-Prot	Medium
`Q9LES9`	Arabidopsis thaliana	sp\|Q9LES9\|FDL22_ARATH Putative F-box/FBD/LRR-repeat protein At3g56780	39.300%	Swiss-Prot	Low
`Q3E944`	Arabidopsis thaliana	sp\|Q3E944\|FDL33_ARATH Putative F-box/FBD/LRR-repeat protein At5g25850	27.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card