LXL04_025893 | RubberDandelionOmics

Gene overview

LXL04_025893

Reference: OH-1004 Chr: Chr05 Coordinates: 118271690-118276942 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2424 bp · LXL04_025893|LXL04_025893|OH1004|cDNA

ATGGAGCGTGTTCACGATAATGTTAGAGGTGTAGTGGTACAAGAAGATAAATTGAGCAGCTTGCCAAATAACCTTATTCATAAGATTCTTTCTTTTTTTGACATAAAATTTGTTGTTCAAACATGTTTATTGTCGTCAAGATGGAAGCTTCTCTGGACGTCAATGCCGTATCTCAACTTCTCAACCGACCGTTTTCCTAATTTACAAAAATTTGACGAATTTGTGACTCATGTTTTGTCTCGCCGCAACCATCAATCAGA...

CDS

Download CDS FASTA

2424 bp · LXL04_025893|LXL04_025893|OH1004|CDS

ATGGAGCGTGTTCACGATAATGTTAGAGGTGTAGTGGTACAAGAAGATAAATTGAGCAGCTTGCCAAATAACCTTATTCATAAGATTCTTTCTTTTTTTGACATAAAATTTGTTGTTCAAACATGTTTATTGTCGTCAAGATGGAAGCTTCTCTGGACGTCAATGCCGTATCTCAACTTCTCAACCGACCGTTTTCCTAATTTACAAAAATTTGACGAATTTGTGACTCATGTTTTGTCTCGCCGCAACCATCAATCAGA...

Protein

Download Protein FASTA

807 aa · LXL04_025893|LXL04_025893|OH1004|PROTEIN

MERVHDNVRGVVVQEDKLSSLPNNLIHKILSFFDIKFVVQTCLLSSRWKLLWTSMPYLNFSTDRFPNLQKFDEFVTHVLSRRNHQSEVTSVKLDFGRAENLGFLKNIASYALSHNVQYLTIDGTTPRRDDCPTCLFSSQSLKQFTLSCRFYPHPNTTITSLDFPALTTLNLAHIEVSGDHFSKCVNLKNLTLECFEVMGREKVFDIITPRLSNLTLIDGKCIINKFIINVIAPQLENLTVIRCEIKYFNAPLGLSSFCYR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025893`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025893

Location Chr05:118271690-118276942 (+)

Description Similar to At4g03220: Putative F-box/FBD/LRR-repeat protein At4g03220

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g03220`	Putative F-box/FBD/LRR-repeat protein At4g03220.	No verified direct reference in this release
`At1g13780`	F-box/FBD/LRR-repeat protein At1g13780.	No verified direct reference in this release
`At3g26922`	F-box/LRR-repeat protein At3g26922.	No verified direct reference in this release
`At1g78760`	Putative F-box/FBD/LRR-repeat protein At1g78760.	No verified direct reference in this release
`At5g02920`	F-box/LRR-repeat protein 25.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025893 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G13780

ath:AT1G78760

ath:AT3G26922

ath:AT4G03220

ath:AT5G02920

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.651

Rank 1 · LXL04_025893 · OH-1004

Nucleus0.404

Rank 2 · LXL04_025893 · OH-1004

Cell membrane0.073

Rank 3 · LXL04_025893 · OH-1004

Endoplasmic reticulum0.060

Rank 4 · LXL04_025893 · OH-1004

Mitochondrion0.041

Rank 5 · LXL04_025893 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646.39F-box18-56 aa

PF24758.2LRR_At5g56370113-242 aa

PF24758.2LRR_At5g56370533-665 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025893	`PF00646.39`	F-box	18	56	5.5e-06	26.8
LXL04_025893	`PF24758.2`	LRR_At5g56370	113	242	1.6e-15	58.1
LXL04_025893	`PF24758.2`	LRR_At5g56370	533	665	1.6e-15	58.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZR09`	Arabidopsis thaliana	Putative F-box/FBD/LRR-repeat protein At4g03220	30.102%	Swiss-Prot	weak database homology
`Q56XS8`	Arabidopsis thaliana	F-box/FBD/LRR-repeat protein At1g13780	30.256%	Swiss-Prot	weak database homology
`Q9LJF8`	Arabidopsis thaliana	F-box/LRR-repeat protein At3g26922	29.730%	Swiss-Prot	weak database homology
`Q9ZV94`	Arabidopsis thaliana	Putative F-box/FBD/LRR-repeat protein At1g78760	25.000%	Swiss-Prot	weak database homology
`Q1PE04`	Arabidopsis thaliana	F-box/LRR-repeat protein 25	27.391%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card