TkA06G031130 | RubberDandelionOmics

Gene overview

TkA06G031130

Reference: TK1151 Chr: Chr06 Coordinates: 8481679-8484382 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1813 bp · TkA06G031130|TK1151|cDNA

TTCACATAACATTTCATTTTGTCGATAACTTTTGTCTTATGAACATGCCTTCTTTCGCTTCTTCCCTTGAACATGATGGGAGTACCAAACAAGATGTTACCCGCAACACTGTCAACTTCCATCCTAGCATTTGGGGAGATCAGTTTCTCACCTATGAAGAGACAAATGATGGAGAATGGGAGGAGCAACAAGTCAATCAACTCAAAGAGGAAGTCCGCAAAATGCTAGTCATCAATACCTCAACCCAAATGATCACACAA...

CDS

Download CDS FASTA

1698 bp · TkA06G031130|TK1151|CDS

ATGAACATGCCTTCTTTCGCTTCTTCCCTTGAACATGATGGGAGTACCAAACAAGATGTTACCCGCAACACTGTCAACTTCCATCCTAGCATTTGGGGAGATCAGTTTCTCACCTATGAAGAGACAAATGATGGAGAATGGGAGGAGCAACAAGTCAATCAACTCAAAGAGGAAGTCCGCAAAATGCTAGTCATCAATACCTCAACCCAAATGATCACACAACATATGAAACTTTTGGAGCTTATTGATGCAATCCAACG...

Protein

Download Protein FASTA

565 aa · TkA06G031130|TK1151|PROTEIN

MNMPSFASSLEHDGSTKQDVTRNTVNFHPSIWGDQFLTYEETNDGEWEEQQVNQLKEEVRKMLVINTSTQMITQHMKLLELIDAIQRLGVAYHFEEEIEECLKHIYLTYGDLWVNDNLDLQTTSLWFRLLRQQGFNVSSGVFNKYKNNDGRFMESITDDVQGMLSLYEASYMRVEDEQVLDEAIVFTTYHLCKKVENLNDGLFKDQIHQALQQPLRKRLPRLEALRYIPIYQQEPSHNEVLLKFAKLDFNLVQELHRKEL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G031130`
TK1151 ID	TkA06G031130
OH-1004 ID	LXL04_026028
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	91.900
Protein coverage (%)	TK1151 100.000 / OH-1004 65.778 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G031130`
Location	Chr06:8481679-8484382 (+)
Description	Similar to CASC125: (E)-beta-farnesene synthase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_026028` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0016102 diterpenoid biosynthetic process Biological Process GO:0046246 terpene biosynthetic process Biological Process GO:0051762 sesquiterpene biosynthetic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0000287 magnesium ion binding Molecular Function GO:0010333 terpene synthase activity Molecular Function GO:0034005 germacrene-A synthase activity Molecular Function GO:0080016 (-)-E-beta-caryophyllene synthase activity Molecular Function
KEGG gene cross-reference	ag:AAL79181 ag:AMP42991 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.694

Rank 1 · TkA06G031130 · TK1151

Plastid0.260

Rank 2 · TkA06G031130 · TK1151

Nucleus0.169

Rank 3 · TkA06G031130 · TK1151

Endoplasmic reticulum0.065

Rank 4 · TkA06G031130 · TK1151

Peroxisome0.056

Rank 5 · TkA06G031130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01397Terpene_synth31-211 aa

PF19086Terpene_syn_C_279-114 aa

PF03936Terpene_synth_C80-107 aa

PF03936Terpene_synth_C268-507 aa

PF19086Terpene_syn_C_2308-507 aa

PF01397Terpene_synth471-499 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G031130	`PF01397`	Terpene_synth	31	211	4.9e-56	190.2
TkA06G031130	`PF19086`	Terpene_syn_C_2	79	114	1.3e-51	175.9
TkA06G031130	`PF03936`	Terpene_synth_C	80	107	1.3e-89	300.4
TkA06G031130	`PF03936`	Terpene_synth_C	268	507	1.3e-89	300.4
TkA06G031130	`PF19086`	Terpene_syn_C_2	308	507	1.3e-51	175.9
TkA06G031130	`PF01397`	Terpene_synth	471	499	4.9e-56	190.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card