LXL04_026028 | RubberDandelionOmics

Gene overview

LXL04_026028

Reference: OH-1004 Chr: Chr05 Coordinates: 119913581-119918492 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2703 bp · LXL04_026028|LXL04_026028|OH1004|cDNA

ATGAACATGCCTTCTTTCGCTTCTTCCCTTGAACATGACGGGAGTATCAAACAAGATGTTACCCGCAACACTGTCAACTTCCATCCTAGCATTTGGGGAGATCAGTTTCTCACCTATGAAGAGACAAATGATGGAGAATGGGGGGAGCAACAAGTCAATCAACTCAAAGAGGAAGTCCGCAAAATGCTAGTCATCAATACCTCAACCCAAATGATCACACACCATAGGAAACTTTTGGAGCTTATTGATGCAATCCAACG...

CDS

Download CDS FASTA

2703 bp · LXL04_026028|LXL04_026028|OH1004|CDS

ATGAACATGCCTTCTTTCGCTTCTTCCCTTGAACATGACGGGAGTATCAAACAAGATGTTACCCGCAACACTGTCAACTTCCATCCTAGCATTTGGGGAGATCAGTTTCTCACCTATGAAGAGACAAATGATGGAGAATGGGGGGAGCAACAAGTCAATCAACTCAAAGAGGAAGTCCGCAAAATGCTAGTCATCAATACCTCAACCCAAATGATCACACACCATAGGAAACTTTTGGAGCTTATTGATGCAATCCAACG...

Protein

Download Protein FASTA

900 aa · LXL04_026028|LXL04_026028|OH1004|PROTEIN

MNMPSFASSLEHDGSIKQDVTRNTVNFHPSIWGDQFLTYEETNDGEWGEQQVNQLKEEVRKMLVINTSTQMITHHRKLLELIDAIQRLGVAYHFEEEIEKCLKHILHLTYGDLWVNDNLDLQTASLWFRLLRQQGFNVSSGVFNKYKNNDGRFMESIIDDVQGMLSLYEASYMRIEGEQILDEAIVFTTCHLSKKVENLNDGLFKDRIHQALQQPLRKRLPRLEALRYIPIYQQEPSHNEVLLKFAKLDFNLLQKLHRKE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026028`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_026028`
Location	Chr05:119913581-119918492 (-)
Description	Similar to CASC125: (E)-beta-farnesene synthase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_026028` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0016102 diterpenoid biosynthetic process Biological Process GO:0046246 terpene biosynthetic process Biological Process GO:0051762 sesquiterpene biosynthetic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0000287 magnesium ion binding Molecular Function GO:0010333 terpene synthase activity Molecular Function GO:0034005 germacrene-A synthase activity Molecular Function GO:0080016 (-)-E-beta-caryophyllene synthase activity Molecular Function
KEGG gene cross-reference	ag:AAL79181 ag:AMP42991 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.973

Rank 1 · LXL04_026028 · OH-1004

Mitochondrion0.040

Rank 2 · LXL04_026028 · OH-1004

Peroxisome0.038

Rank 3 · LXL04_026028 · OH-1004

Cytoplasm0.036

Rank 4 · LXL04_026028 · OH-1004

Cell membrane0.018

Rank 5 · LXL04_026028 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01397.28Terpene_synth31-212 aa

PF03936.22Terpene_synth_C269-470 aa

PF19086.6Terpene_syn_C_2309-470 aa

PF19086.6Terpene_syn_C_2492-534 aa

PF03936.22Terpene_synth_C493-534 aa

PF00574.29CLP_protease686-860 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026028	`PF01397.28`	Terpene_synth	31	212	2.7e-54	184.5
LXL04_026028	`PF03936.22`	Terpene_synth_C	269	470	5.3e-82	275.5
LXL04_026028	`PF19086.6`	Terpene_syn_C_2	309	470	7.2e-45	153.9
LXL04_026028	`PF19086.6`	Terpene_syn_C_2	492	534	7.2e-45	153.9
LXL04_026028	`PF03936.22`	Terpene_synth_C	493	534	5.3e-82	275.5
LXL04_026028	`PF00574.29`	CLP_protease	686	860	5.5e-71	238.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card