RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA06G027400
Reference: TK1151 Chr: Chr06 Coordinates: 7409346-7416576 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3256 bp · TkA06G027400|TK1151|cDNA

TAAGAAACGCATGCATCGTCTAATGAGATTGTGCCACGTGTATGAAACAGCCATGTAGGTCAAAAGTAGTCAATCGGTTTCTTCTTCTCCCATCCCCACAGGCCACAGTATTTATGGTCTCATTTACCACCAACCCATCTCCCCACAATTAAAACAAATATTATCTCTCTTTGCAACAAAGAGATCCAAGGAGCTTCCATCAGAAATTACACCGACACTGCTGGATGATGATTTGATTACATCTGTTGAAGAAGTTTTTC...

CDS

Download CDS FASTA

2454 bp · TkA06G027400|TK1151|CDS

ATGTACGGAGATTGCCAAGTGATGTCAACCATGGGTGGTGGAACTGGGATTCCTTCTGAATCAATCTTTCCCAACTTCAACTTCATGCCTTTCACCGATTTCTCTTCCGTCATCCCAAAAGAGGAGATGGAAAGCATGGCGAAACCAGGAAAAGAGGAGATGGAAAGCGGGTCGGGAAGCGAACAAAATGAAGGTGGAGTTTCTGGAAACGAACAAGACACCGATCAACAGCCCCCTGCGAAGAAGAAGCGTTATCACAG...

Protein

Download Protein FASTA

817 aa · TkA06G027400|TK1151|PROTEIN

MYGDCQVMSTMGGGTGIPSESIFPNFNFMPFTDFSSVIPKEEMESMAKPGKEEMESGSGSEQNEGGVSGNEQDTDQQPPAKKKRYHRHTAHQIQEMEALFKECPHPDDKRRMRLSQELGLKPRQVKFWFQNRRTQMKAQQDRTDNAILRNDNDNLRNENSRLQSALRALVCSNCGGSSISFDEQQLRMENARLKDELDRVCLIASQFCGSDPMQGQAQGHHGPLPSMMTSNLNLDMNMYPRAYDQEGLPNCSEMLHINPL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA06G027400
TK1151 IDTkA06G027400
OH-1004 IDLXL04_010080
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)48.600
Protein coverage (%)TK1151 88.127 / OH-1004 95.455
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA06G027400
LocationChr06:7409346-7416576 (-)
DescriptionSimilar to PDF2: Homeobox-leucine zipper protein PROTODERMAL FACTOR 2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g46880 Probable transcription factor (By similarity).
Mutations in epidermis-specific HD-ZIP IV genes affect floral organ identity in Arabidopsis thaliana.2013 · DOI: 10.1111/tpj.12211
At4g17710 Probable transcription factor. No verified direct reference in this release
At4g04890 Probable transcription factor that binds to the L1 box DNA sequence 5'-TAAATG[CT]A-3'.
Regulation of shoot epidermal cell differentiation by a pair of homeodomain proteins in Arabidopsis.2003 · DOI: 10.1242/dev.00292
Mutations in epidermis-specific HD-ZIP IV genes affect floral organ identity in Arabidopsis thaliana.2013 · DOI: 10.1111/tpj.12211
Arabidopsis DELLA and two HD-ZIP transcription factors regulate GA signaling in the epidermis through the L1 box cis-element.2014 · DOI: 10.1105/tpc.114.127647

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: A2ZAI7 Probable transcription factor. No verified direct reference in this release
Os10g0575600 Probable transcription factor. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_010080 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0009845 seed germination Biological Process
GO:0010029 regulation of seed germination Biological Process
GO:0010090 trichome morphogenesis Biological Process
GO:0010214 seed coat development Biological Process
GO:0030154 cell differentiation Biological Process
GO:0048354 mucilage biosynthetic process involved in seed coat development Biological Process
GO:0048497 maintenance of floral organ identity Biological Process
GO:0048825 cotyledon development Biological Process
GO:0052541 plant-type cell wall cellulose metabolic process Biological Process
GO:0090627 plant epidermal cell differentiation Biological Process
GO:2000033 regulation of seed dormancy process Biological Process
KEGG gene cross-reference
ath:AT1G05230
ath:AT4G04890
ath:AT4G21750
dosa:Os04g0627000
dosa:Os08g0187500
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.927
Rank 1 · TkA06G027400 · TK1151
Cytoplasm0.121
Rank 2 · TkA06G027400 · TK1151
Cell membrane0.043
Rank 3 · TkA06G027400 · TK1151
Plastid0.023
Rank 4 · TkA06G027400 · TK1151
Endoplasmic reticulum0.022
Rank 5 · TkA06G027400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00046Homeodomain82-137 aa
PF13621Cupin_886-146 aa
PF05920Homeobox_KN103-134 aa
PF02183HALZ148-169 aa
PF02183HALZ183-198 aa
PF01852START289-512 aa
PF02183HALZ505-515 aa
PF25797PDF2_C529-771 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA06G027400PF00046Homeodomain821371e-1970.8
TkA06G027400PF13621Cupin_8861460.2112.2
TkA06G027400PF05920Homeobox_KN1031346.2e-0523.5
TkA06G027400PF02183HALZ1481690.1113.4
TkA06G027400PF02183HALZ1831980.1113.4
TkA06G027400PF01852START2895125.1e-36124.7
TkA06G027400PF02183HALZ5055150.1113.4
TkA06G027400PF25797PDF2_C5297711.1e-84284.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FJS2Arabidopsis thalianasp|Q9FJS2|HDG5_ARATH Homeobox-leucine zipper protein HDG554.500%Swiss-ProtHigh
Q8L7H4Arabidopsis thalianasp|Q8L7H4|HDG4_ARATH Homeobox-leucine zipper protein HDG448.900%Swiss-ProtMedium
Q93V99Arabidopsis thalianasp|Q93V99|PDF2_ARATH Homeobox-leucine zipper protein PROTODERMAL FACTOR 246.300%Swiss-ProtMedium
A2ZAI7Oryza sativa subsp. indicasp|A2ZAI7|ROC3_ORYSI Homeobox-leucine zipper protein ROC351.200%Swiss-ProtHigh
Q336P2Oryza sativa subsp. japonicasp|Q336P2|ROC3_ORYSJ Homeobox-leucine zipper protein ROC351.000%Swiss-ProtHigh

JBrowse

View in Genome Browser