TkA06G024460 | RubberDandelionOmics

Gene overview

TkA06G024460

Reference: TK1151 Chr: Chr06 Coordinates: 6667997-6670078 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1647 bp · TkA06G024460|TK1151|cDNA

AGATTATCTGTAAAAACGAGAACCCCACTCGCCAAAGTTTGCCACATTCTGACGAATCTTTGTTGTTTGTTTGCCTTTTCGATGGCCACTCCCCACCTACAATTCCGCCAAATTTTGGCATTTTAGTGAGTGGGAGATTAATCGGTGAATCTGGTCCTCAATTCTTCTGTATTCTCTTACAGGTTCATTTCTCATCTTCTTCCGTATATATGTGTGTTCATTTGAGGTCCAACTCAAACCAACGCAATCCTATCTTGTCC...

CDS

Download CDS FASTA

906 bp · TkA06G024460|TK1151|CDS

ATGGGTGACGTGGCAAAGGACTTAGCGGCGGGAACGGTTGGAGGTGTAGCCCAGTTGATAGTTGGGCATCCTTTTGATACCATCAAGGTGAAACTCCAAAGTCAACCGACCCCATTACCTGGTCAACTCCCCAAATACTCCGGTGCCATAGATGCCGTTAAAAAAACATTGGCCGCTCAAGGTGCCGGAGGTCTGTACAAAGGCATGGGAGCCCCACTTGCCACGGTGGCAGTCTTCAATGCGGTGTTGTTCTCAGTTAG...

Protein

Download Protein FASTA

301 aa · TkA06G024460|TK1151|PROTEIN

MGDVAKDLAAGTVGGVAQLIVGHPFDTIKVKLQSQPTPLPGQLPKYSGAIDAVKKTLAAQGAGGLYKGMGAPLATVAVFNAVLFSVRGQMEALLKSEPGASLTVKQQFIAGAGAGFAVSFLATPTELLKCRLQAQGAGAAVAEGAAAATAALKYSGPMDVARQVLKSEGGALGLFKGFFPTIVREVPGNATMFGVYEALKQYIAGGTDTSGLSRGSLMMAGGLAGGAFWISVYPADVVKSVIQIDDFKNPKYSGAFDAFK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G024460`
TK1151 ID	TkA06G024460
OH-1004 ID	LXL04_026151
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 59.722 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G024460

Location Chr06:6667997-6670078 (+)

Description Similar to BOU: Mitochondrial carnitine/acylcarnitine carrier-like protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g46800`	Involved in photorespiratory metabolism.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026151 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006839 mitochondrial transport Biological Process

GO:0140021 mitochondrial ADP transmembrane transport Biological Process

GO:1902603 carnitine transmembrane transport Biological Process

GO:1990544 mitochondrial ATP transmembrane transport Biological Process

GO:1990575 mitochondrial L-ornithine transmembrane transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005740 mitochondrial envelope Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0000064 L-ornithine transmembrane transporter activity Molecular Function

GO:0005471 ATP:ADP antiporter activity Molecular Function

KEGG gene cross-reference

ath:AT5G46800

cel:CELE_F49E8.5

ddi:DDB_G0290913

ddi:DDB_G0293556

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.921

Rank 1 · TkA06G024460 · TK1151

Plastid0.034

Rank 2 · TkA06G024460 · TK1151

Cytoplasm0.034

Rank 3 · TkA06G024460 · TK1151

Nucleus0.023

Rank 4 · TkA06G024460 · TK1151

Cell membrane0.017

Rank 5 · TkA06G024460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00153Mito_carr4-95 aa

PF00153Mito_carr103-204 aa

PF00153Mito_carr216-299 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G024460	`PF00153`	Mito_carr	4	95	1.4e-64	214.6
TkA06G024460	`PF00153`	Mito_carr	103	204	1.4e-64	214.6
TkA06G024460	`PF00153`	Mito_carr	216	299	1.4e-64	214.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93XM7`	Arabidopsis thaliana	sp\|Q93XM7\|MCAT_ARATH Mitochondrial carnitine/acylcarnitine carrier-like protein	75.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card