LXL04_026151 | RubberDandelionOmics

Gene overview

LXL04_026151

Reference: OH-1004 Chr: Chr05 Coordinates: 121867638-121870200 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1515 bp · LXL04_026151|LXL04_026151|OH1004|cDNA

ATGGGAGTGACAGGCGTAGAAAAGTTGATTGGCGCAAGGTGGGAAATGGGTTCGGAAGAATTGTATGTGTACTCTTCCAAAAACAACGATATTAGTAATCAATTCTCGGTGGATAAGTTGGTAATTTCGTATTGGGAGATTATCTGTAAAAACGAGAACCCCACTCGCCAAAGTTTGCCACATTCTGACGAATCTTTGTTGTTTGTTTGCCTTTTCGATGGCCACTCCCCACCTACAATTCCGCCAAATTTTGGCATTTT...

CDS

Download CDS FASTA

1515 bp · LXL04_026151|LXL04_026151|OH1004|CDS

ATGGGAGTGACAGGCGTAGAAAAGTTGATTGGCGCAAGGTGGGAAATGGGTTCGGAAGAATTGTATGTGTACTCTTCCAAAAACAACGATATTAGTAATCAATTCTCGGTGGATAAGTTGGTAATTTCGTATTGGGAGATTATCTGTAAAAACGAGAACCCCACTCGCCAAAGTTTGCCACATTCTGACGAATCTTTGTTGTTTGTTTGCCTTTTCGATGGCCACTCCCCACCTACAATTCCGCCAAATTTTGGCATTTT...

Protein

Download Protein FASTA

504 aa · LXL04_026151|LXL04_026151|OH1004|PROTEIN

MGVTGVEKLIGARWEMGSEELYVYSSKNNDISNQFSVDKLVISYWEIICKNENPTRQSLPHSDESLLFVCLFDGHSPPTIPPNFGILVSGRLIGESGPQFFCILLQVHFSSSSVYMCVHLRSNSNQRNPILSISPTSPSLWLSNLSRFQYPTNDFCFYYHQPSIFLKKIPLFKIHPSKAYGNSPIANTHLVESWDHLFIDQSQMGDVAKDLAAGTVGGVAQLIVGHPFDTIKVKLQSQPTPLPGQLPKYSGAIDAVKKTL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026151`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026151

Location Chr05:121867638-121870200 (-)

Description Similar to BOU: Mitochondrial carnitine/acylcarnitine carrier-like protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g46800`	Involved in photorespiratory metabolism.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026151 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006839 mitochondrial transport Biological Process

GO:0140021 mitochondrial ADP transmembrane transport Biological Process

GO:1902603 carnitine transmembrane transport Biological Process

GO:1990544 mitochondrial ATP transmembrane transport Biological Process

GO:1990575 mitochondrial L-ornithine transmembrane transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005740 mitochondrial envelope Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0000064 L-ornithine transmembrane transporter activity Molecular Function

GO:0005471 ATP:ADP antiporter activity Molecular Function

KEGG gene cross-reference

ath:AT5G46800

cel:CELE_F49E8.5

ddi:DDB_G0290913

ddi:DDB_G0293556

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.770

Rank 1 · LXL04_026151 · OH-1004

Mitochondrion0.233

Rank 2 · LXL04_026151 · OH-1004

Cytoplasm0.046

Rank 3 · LXL04_026151 · OH-1004

Nucleus0.026

Rank 4 · LXL04_026151 · OH-1004

Peroxisome0.020

Rank 5 · LXL04_026151 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00153.33Mito_carr207-298 aa

PF00153.33Mito_carr306-407 aa

PF00153.33Mito_carr419-502 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026151	`PF00153.33`	Mito_carr	207	298	2.2e-63	210.7
LXL04_026151	`PF00153.33`	Mito_carr	306	407	2.2e-63	210.7
LXL04_026151	`PF00153.33`	Mito_carr	419	502	2.2e-63	210.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93XM7`	Arabidopsis thaliana	Mitochondrial carnitine/acylcarnitine carrier-like protein	75.415%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card