TkA06G023230 | RubberDandelionOmics

Gene overview

TkA06G023230

Reference: TK1151 Chr: Chr06 Coordinates: 6362141-6366983 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

990 bp · TkA06G023230|TK1151|cDNA

CCAAAATTCTCCCCCTTCATCTTTCCAAAATGGCATTTTCGCTTCAAATTCTCTTCATAGTTTCTGCATTGATATTTTCTTTGATAAATCCTGCCACATCAGATAGCCCTTTCATCCATTCTCGAGCAGCATACTATCCAGATTCTGATGAAAAAGGATCCGATAAAGGAAGATGTGGATATGGTTCATTTGGAGCAACAATTAACAATGGATATGTGGCAGATGCATCTGATCTTTACAGAGATGGTGTAGGTTGTGGT...

CDS

Download CDS FASTA

762 bp · TkA06G023230|TK1151|CDS

ATGGCATTTTCGCTTCAAATTCTCTTCATAGTTTCTGCATTGATATTTTCTTTGATAAATCCTGCCACATCAGATAGCCCTTTCATCCATTCTCGAGCAGCATACTATCCAGATTCTGATGAAAAAGGATCCGATAAAGGAAGATGTGGATATGGTTCATTTGGAGCAACAATTAACAATGGATATGTGGCAGATGCATCTGATCTTTACAGAGATGGTGTAGGTTGTGGTGCTTGCTACCAGGTGAGGTGCACCAACAG...

Protein

Download Protein FASTA

253 aa · TkA06G023230|TK1151|PROTEIN

MAFSLQILFIVSALIFSLINPATSDSPFIHSRAAYYPDSDEKGSDKGRCGYGSFGATINNGYVADASDLYRDGVGCGACYQVRCTNSKDCSNEGVNIVITDQGSSDRTDFIMSKKAFRKMAQSPYSETSLLSQGIVDIEYRRVSCNYPKNNITIKIDESSDYPYYLAFVIWYQQGQKDITAVQLCETKNFVCKLLDRSYGSVFTTTSPPSGSLSLRMLFSGEDGDEKWVVPVNIIPDNWRKGDIYDTVVQVTE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G023230`
TK1151 ID	TkA06G023230
OH-1004 ID	LXL04_026173
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.800
Protein coverage (%)	TK1151 99.605 / OH-1004 53.277 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G023230

Location Chr06:6362141-6366983 (-)

Description Similar to EXLB1: Expansin-like B1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g17030`	Expansin-like B1.	No verified direct reference in this release
`At4g38400`	Expansin-like A2.	No verified direct reference in this release
`At3g45960`	Expansin-like A3.	No verified direct reference in this release
`At3g45970`	Expansin-like A1.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0496250`	Expansin-like B1.	No verified direct reference in this release
`Os03g0132200`	Expansin-like A1.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026173 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009653 anatomical structure morphogenesis Biological Process

GO:0009828 plant-type cell wall loosening Biological Process

GO:0005576 extracellular region Cellular Component

KEGG gene cross-reference

ath:AT4G17030

dosa:Os03g0132200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.493

Rank 1 · TkA06G023230 · TK1151

Lysosome / Vacuole0.126

Rank 2 · TkA06G023230 · TK1151

Cytoplasm0.109

Rank 3 · TkA06G023230 · TK1151

Endoplasmic reticulum0.105

Rank 4 · TkA06G023230 · TK1151

Cell membrane0.090

Rank 5 · TkA06G023230 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29515Expansin_N6-125 aa

PF03330DPBB_168-140 aa

PF01357Expansin_C152-236 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G023230	`PF29515`	Expansin_N	6	125	2.4e-09	38.1
TkA06G023230	`PF03330`	DPBB_1	68	140	1e-12	48.8
TkA06G023230	`PF01357`	Expansin_C	152	236	5.4e-13	49.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23547`	Arabidopsis thaliana	sp\|O23547\|EXLB1_ARATH Expansin-like B1	43.800%	Swiss-Prot	Medium
`Q9SVE5`	Arabidopsis thaliana	sp\|Q9SVE5\|EXLA2_ARATH Expansin-like A2	37.300%	Swiss-Prot	Medium
`Q9LZT5`	Arabidopsis thaliana	sp\|Q9LZT5\|EXLA3_ARATH Expansin-like A3	38.100%	Swiss-Prot	Medium
`Q9LZT4`	Arabidopsis thaliana	sp\|Q9LZT4\|EXLA1_ARATH Expansin-like A1	38.500%	Swiss-Prot	Medium
`Q850K7`	Oryza sativa subsp. japonica	sp\|Q850K7\|EXLB1_ORYSJ Expansin-like B1	59.800%	Swiss-Prot	High
`Q10S70`	Oryza sativa subsp. japonica	sp\|Q10S70\|EXLA1_ORYSJ Expansin-like A1	41.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card