TkA06G021570 | RubberDandelionOmics

Gene overview

TkA06G021570

Reference: TK1151 Chr: Chr06 Coordinates: 5912025-5914275 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1800 bp · TkA06G021570|TK1151|cDNA

ATTTTCATAAATGGCTCTATCACCCCCCGTGTATTTATAGCTACGAAGCTCCACCACTTGAGCCTTTTGTGTTTCCCTCTTCCTTTCTCCGAATAAACCAGACGACAAAAAATCACAACGATCCACAATCCACCTGAAACCCCAAATCATCTACAAACTCATAGATCAAATCGAAATTTCACGCCTAATTCAAAATTTTCTAGGGTTGCGAGGATTGGTTGAGGTGCACCGATGTGTAATCGTTTCGGGTTTTATTAATT...

CDS

Download CDS FASTA

750 bp · TkA06G021570|TK1151|CDS

ATGCGTCAGAAGAAAACCGGCCTTCAGATCGGAGAAGAACGAACCTCTTCCGATTCAAAAACTCCACAATTTCAATTTAAAAAAAACTCGGATTTCAAAGGCAACTACGTATCAAGGATCCCCCATCTTCAAATCCAAATACCCACGAGAGATTATAATGAACAGCGACCCACTTTCAAGCAAAGCGCAACCACGACAGCAACAGCCACCAACACCCAGAAAACTCTTCTTTCAAATCCTCAGAAACGACCTGTGGTTAT...

Protein

Download Protein FASTA

249 aa · TkA06G021570|TK1151|PROTEIN

MRQKKTGLQIGEERTSSDSKTPQFQFKKNSDFKGNYVSRIPHLQIQIPTRDYNEQRPTFKQSATTTATATNTQKTLLSNPQKRPVVMSPQQKSSPHHHHHHHHHHPYTQPRRTSHQKSLICCSSSEALLATKTVALKLLKFTHVKLFWIKVPFRVLLLLFLPSIYYFSLSYRSFYLYVLFLIAFCSVLLSSFNINTFHTTNLPSIRLFVARKFPNLKLYKSDNASTTNTPVVWSIGSNPNSKKTQIQGS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G021570`
TK1151 ID	TkA06G021570
OH-1004 ID	LXL04_026204
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.600
Protein coverage (%)	TK1151 95.984 / OH-1004 46.318 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G021570`
Location	Chr06:5912025-5914275 (+)
Description	Similar to PIP5K1: Phosphatidylinositol 4-phosphate 5-kinase 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_026204` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009827 plant-type cell wall modification Biological Process GO:0009846 pollen germination Biological Process GO:0009860 pollen tube growth Biological Process GO:0046488 phosphatidylinositol metabolic process Biological Process GO:0046854 phosphatidylinositol phosphate biosynthetic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0016324 apical plasma membrane Cellular Component GO:0090406 pollen tube Cellular Component GO:0003785 actin monomer binding Molecular Function GO:0005524 ATP binding Molecular Function
KEGG gene cross-reference	ath:AT1G21980 ath:AT1G60890 ath:AT2G41210 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.476

Rank 1 · TkA06G021570 · TK1151

Cytoplasm0.386

Rank 2 · TkA06G021570 · TK1151

Mitochondrion0.126

Rank 3 · TkA06G021570 · TK1151

Cell membrane0.063

Rank 4 · TkA06G021570 · TK1151

Endoplasmic reticulum0.058

Rank 5 · TkA06G021570 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04592SelP_N66-113 aa

PF28152HpnL90-109 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G021570	`PF04592`	SelP_N	66	113	5.7	7.0
TkA06G021570	`PF28152`	HpnL	90	109	1.2	10.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card